Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL15_RS07090 | Genome accession | NZ_LS483323 |
| Coordinates | 1396416..1396598 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8300 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1395520..1446487 | 1396416..1396598 | within | 0 |
Gene organization within MGE regions
Location: 1395520..1446487
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL15_RS07080 (NCTC8300_01401) | - | 1395520..1395756 (-) | 237 | WP_002990844.1 | DUF2829 domain-containing protein | - |
| DQL15_RS07090 (NCTC8300_01402) | prx | 1396416..1396598 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| DQL15_RS07095 (NCTC8300_01403) | - | 1396831..1397817 (+) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| DQL15_RS07100 (NCTC8300_01404) | - | 1397931..1398446 (-) | 516 | WP_023077389.1 | hypothetical protein | - |
| DQL15_RS07105 (NCTC8300_01405) | - | 1398768..1399964 (-) | 1197 | WP_111689249.1 | glucosaminidase domain-containing protein | - |
| DQL15_RS07110 (NCTC8300_01407) | - | 1400075..1400260 (-) | 186 | WP_002988802.1 | holin | - |
| DQL15_RS07115 (NCTC8300_01408) | - | 1400257..1400553 (-) | 297 | WP_111689250.1 | hypothetical protein | - |
| DQL15_RS07120 (NCTC8300_01409) | - | 1400563..1401174 (-) | 612 | WP_111689251.1 | DUF1366 domain-containing protein | - |
| DQL15_RS07125 (NCTC8300_01410) | - | 1401171..1401608 (-) | 438 | WP_023613191.1 | DUF1617 family protein | - |
| DQL15_RS07130 (NCTC8300_01411) | - | 1401620..1403638 (-) | 2019 | WP_111689252.1 | gp58-like family protein | - |
| DQL15_RS07135 (NCTC8300_01412) | - | 1403648..1404766 (-) | 1119 | WP_111689253.1 | hyaluronoglucosaminidase | - |
| DQL15_RS07140 (NCTC8300_01413) | - | 1404763..1406742 (-) | 1980 | WP_111689254.1 | phage tail protein | - |
| DQL15_RS07145 (NCTC8300_01414) | - | 1406752..1407594 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| DQL15_RS07150 (NCTC8300_01415) | - | 1407606..1411988 (-) | 4383 | WP_111689255.1 | tape measure protein | - |
| DQL15_RS07155 (NCTC8300_01416) | - | 1412003..1412236 (-) | 234 | WP_011054867.1 | hypothetical protein | - |
| DQL15_RS07160 (NCTC8300_01417) | - | 1412311..1412766 (-) | 456 | WP_111689256.1 | tail assembly chaperone | - |
| DQL15_RS07165 (NCTC8300_01418) | - | 1412820..1413419 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| DQL15_RS07170 (NCTC8300_01419) | - | 1413431..1413790 (-) | 360 | WP_011054870.1 | hypothetical protein | - |
| DQL15_RS07175 (NCTC8300_01420) | - | 1413794..1414138 (-) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL15_RS07180 (NCTC8300_01421) | - | 1414135..1414413 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| DQL15_RS07185 (NCTC8300_01422) | - | 1414424..1414780 (-) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| DQL15_RS07190 (NCTC8300_01423) | - | 1414792..1415679 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| DQL15_RS07195 (NCTC8300_01424) | - | 1415692..1416261 (-) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| DQL15_RS07200 (NCTC8300_01425) | - | 1416429..1416695 (-) | 267 | WP_011054875.1 | hypothetical protein | - |
| DQL15_RS07205 | - | 1416700..1416888 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| DQL15_RS07210 (NCTC8300_01427) | - | 1416916..1418364 (-) | 1449 | WP_011054877.1 | minor capsid protein | - |
| DQL15_RS07215 (NCTC8300_01428) | - | 1418324..1419856 (-) | 1533 | WP_011106638.1 | phage portal protein | - |
| DQL15_RS07220 (NCTC8300_01429) | - | 1419872..1421149 (-) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| DQL15_RS07225 (NCTC8300_01430) | - | 1421139..1421591 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| DQL15_RS07230 (NCTC8300_01431) | - | 1421681..1422097 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQL15_RS07235 (NCTC8300_01432) | - | 1422230..1422502 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQL15_RS09175 (NCTC8300_01433) | - | 1422495..1422665 (-) | 171 | WP_011054883.1 | hypothetical protein | - |
| DQL15_RS07240 (NCTC8300_01434) | - | 1422666..1423988 (-) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| DQL15_RS07245 (NCTC8300_01435) | - | 1423985..1424260 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQL15_RS07250 (NCTC8300_01436) | - | 1424626..1427010 (-) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| DQL15_RS07255 (NCTC8300_01437) | - | 1427015..1428937 (-) | 1923 | WP_011054887.1 | DNA polymerase | - |
| DQL15_RS07260 (NCTC8300_01438) | - | 1428980..1429543 (-) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| DQL15_RS07265 (NCTC8300_01439) | - | 1429557..1430714 (-) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| DQL15_RS07270 (NCTC8300_01440) | - | 1430714..1431013 (-) | 300 | WP_000573833.1 | hypothetical protein | - |
| DQL15_RS07275 (NCTC8300_01441) | - | 1431101..1431304 (-) | 204 | WP_011054890.1 | hypothetical protein | - |
| DQL15_RS07280 (NCTC8300_01443) | - | 1431450..1431833 (-) | 384 | WP_011054892.1 | hypothetical protein | - |
| DQL15_RS07285 (NCTC8300_01444) | - | 1431830..1432036 (-) | 207 | WP_021734004.1 | hypothetical protein | - |
| DQL15_RS07290 (NCTC8300_01445) | - | 1432029..1432199 (-) | 171 | WP_011054894.1 | hypothetical protein | - |
| DQL15_RS07295 (NCTC8300_01446) | - | 1432228..1432485 (-) | 258 | WP_011054895.1 | hypothetical protein | - |
| DQL15_RS07300 (NCTC8300_01447) | - | 1432573..1432773 (-) | 201 | WP_011184050.1 | hypothetical protein | - |
| DQL15_RS07305 (NCTC8300_01448) | - | 1432824..1433015 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| DQL15_RS07310 (NCTC8300_01449) | - | 1433654..1434004 (+) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| DQL15_RS07315 (NCTC8300_01450) | - | 1434018..1434401 (+) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL15_RS07320 (NCTC8300_01451) | - | 1434412..1434963 (+) | 552 | WP_011054899.1 | hypothetical protein | - |
| DQL15_RS07325 (NCTC8300_01452) | - | 1435139..1436227 (+) | 1089 | WP_011054900.1 | site-specific integrase | - |
| DQL15_RS07330 (NCTC8300_01453) | - | 1436447..1437415 (+) | 969 | WP_002990848.1 | DUF3644 domain-containing protein | - |
| DQL15_RS07335 (NCTC8300_01454) | - | 1437927..1438559 (+) | 633 | WP_002990849.1 | hypothetical protein | - |
| DQL15_RS07340 (NCTC8300_01455) | - | 1438653..1438904 (-) | 252 | WP_002990852.1 | hypothetical protein | - |
| DQL15_RS07345 (NCTC8300_01456) | - | 1439145..1439558 (-) | 414 | WP_011527491.1 | hypothetical protein | - |
| DQL15_RS07350 (NCTC8300_01457) | - | 1440001..1440435 (-) | 435 | WP_002990857.1 | hypothetical protein | - |
| DQL15_RS07355 (NCTC8300_01458) | - | 1440931..1441413 (-) | 483 | WP_019418816.1 | hypothetical protein | - |
| DQL15_RS07360 (NCTC8300_01459) | - | 1441878..1442630 (+) | 753 | WP_002990865.1 | ADP-ribosyltransferase | - |
| DQL15_RS07370 (NCTC8300_01460) | nrdE | 1442835..1445015 (-) | 2181 | WP_002990868.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| DQL15_RS07375 (NCTC8300_01461) | nrdI | 1444982..1445470 (-) | 489 | WP_111689257.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| DQL15_RS07380 (NCTC8300_01462) | nrdF | 1445474..1446487 (-) | 1014 | WP_010921941.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=1136491 DQL15_RS07090 WP_011054856.1 1396416..1396598(-) (prx) [Streptococcus pyogenes strain NCTC8300]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136491 DQL15_RS07090 WP_011054856.1 1396416..1396598(-) (prx) [Streptococcus pyogenes strain NCTC8300]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |