Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL05_RS04000 | Genome accession | NZ_LS483322 |
| Coordinates | 770680..770868 (+) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain NCTC12066 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 728890..778456 | 770680..770868 | within | 0 |
Gene organization within MGE regions
Location: 728890..778456
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL05_RS03720 (NCTC12066_00734) | - | 728890..729510 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DQL05_RS03725 (NCTC12066_00735) | - | 729873..730961 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| DQL05_RS03730 (NCTC12066_00736) | - | 731081..731386 (-) | 306 | WP_011106738.1 | membrane protein | - |
| DQL05_RS03735 (NCTC12066_00737) | - | 731396..732184 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| DQL05_RS03740 (NCTC12066_00739) | - | 732555..732701 (+) | 147 | WP_011054593.1 | hypothetical protein | - |
| DQL05_RS03745 (NCTC12066_00741) | - | 732835..733614 (-) | 780 | WP_011054591.1 | hypothetical protein | - |
| DQL05_RS03750 (NCTC12066_00742) | - | 733671..733877 (+) | 207 | WP_011054590.1 | hypothetical protein | - |
| DQL05_RS03755 (NCTC12066_00743) | - | 733866..734252 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DQL05_RS03760 (NCTC12066_00744) | - | 734326..734565 (+) | 240 | WP_014411882.1 | helix-turn-helix domain-containing protein | - |
| DQL05_RS03770 (NCTC12066_00746) | - | 734781..734990 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQL05_RS03775 (NCTC12066_00747) | - | 735141..735380 (-) | 240 | WP_011054586.1 | hypothetical protein | - |
| DQL05_RS03780 (NCTC12066_00748) | - | 735547..735732 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQL05_RS03785 (NCTC12066_00749) | - | 735810..736106 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| DQL05_RS09105 (NCTC12066_00750) | - | 736103..736237 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| DQL05_RS03790 (NCTC12066_00751) | - | 736253..736567 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| DQL05_RS03795 (NCTC12066_00752) | - | 736796..737278 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQL05_RS03800 (NCTC12066_00753) | - | 737279..737959 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQL05_RS03805 (NCTC12066_00754) | - | 738061..739290 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DQL05_RS03810 (NCTC12066_00755) | - | 739306..739764 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQL05_RS03815 (NCTC12066_00756) | - | 739767..740579 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DQL05_RS09210 (NCTC12066_00757) | - | 740569..741123 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| DQL05_RS03820 (NCTC12066_00758) | - | 741051..742043 (+) | 993 | WP_231870944.1 | phage/plasmid primase, P4 family | - |
| DQL05_RS03825 (NCTC12066_00759) | - | 742305..742718 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| DQL05_RS03830 (NCTC12066_00760) | - | 742715..743035 (+) | 321 | WP_111692026.1 | VRR-NUC domain-containing protein | - |
| DQL05_RS03835 (NCTC12066_00761) | - | 743019..743222 (+) | 204 | WP_011054575.1 | hypothetical protein | - |
| DQL05_RS03840 (NCTC12066_00762) | - | 743219..743503 (+) | 285 | WP_011106747.1 | hypothetical protein | - |
| DQL05_RS03845 (NCTC12066_00763) | - | 743528..743902 (+) | 375 | WP_023609812.1 | methyltransferase domain-containing protein | - |
| DQL05_RS03850 (NCTC12066_00764) | - | 744093..744494 (+) | 402 | WP_011054573.1 | hypothetical protein | - |
| DQL05_RS03855 (NCTC12066_00765) | - | 744494..745129 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| DQL05_RS03865 (NCTC12066_00766) | - | 745402..745842 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL05_RS03875 (NCTC12066_00767) | - | 746428..746766 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQL05_RS03880 (NCTC12066_00768) | - | 746937..747404 (+) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| DQL05_RS03885 (NCTC12066_00769) | - | 747419..749173 (+) | 1755 | WP_011054568.1 | terminase large subunit | - |
| DQL05_RS08855 (NCTC12066_00770) | - | 749170..749340 (+) | 171 | WP_011054567.1 | hypothetical protein | - |
| DQL05_RS03890 (NCTC12066_00771) | - | 749333..749599 (+) | 267 | WP_011054566.1 | hypothetical protein | - |
| DQL05_RS03895 (NCTC12066_00772) | - | 749633..750853 (+) | 1221 | WP_011054565.1 | phage portal protein | - |
| DQL05_RS03900 (NCTC12066_00773) | - | 750831..751496 (+) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| DQL05_RS03905 (NCTC12066_00774) | - | 751522..752706 (+) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| DQL05_RS09110 | - | 752720..752848 (+) | 129 | WP_011054562.1 | hypothetical protein | - |
| DQL05_RS03910 (NCTC12066_00775) | - | 752851..753153 (+) | 303 | WP_011054561.1 | head-tail connector protein | - |
| DQL05_RS03915 (NCTC12066_00776) | - | 753150..753488 (+) | 339 | WP_011054560.1 | phage head closure protein | - |
| DQL05_RS03920 (NCTC12066_00777) | - | 753485..753862 (+) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL05_RS03925 (NCTC12066_00778) | - | 753859..754284 (+) | 426 | WP_011054558.1 | hypothetical protein | - |
| DQL05_RS03930 (NCTC12066_00779) | - | 754303..754914 (+) | 612 | WP_011054557.1 | major tail protein | - |
| DQL05_RS03935 (NCTC12066_00780) | gpG | 754967..755293 (+) | 327 | WP_109828924.1 | phage tail assembly chaperone G | - |
| DQL05_RS08860 | - | 755341..755490 (+) | 150 | WP_023609816.1 | hypothetical protein | - |
| DQL05_RS03940 (NCTC12066_00781) | - | 755503..759426 (+) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| DQL05_RS03945 (NCTC12066_00782) | - | 759426..760133 (+) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| DQL05_RS03950 (NCTC12066_00783) | - | 760130..762277 (+) | 2148 | WP_111692027.1 | phage tail spike protein | - |
| DQL05_RS03955 (NCTC12066_00784) | - | 762277..763386 (+) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| DQL05_RS03960 (NCTC12066_00785) | - | 763396..765414 (+) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| DQL05_RS03965 (NCTC12066_00786) | - | 765426..765857 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| DQL05_RS03970 (NCTC12066_00787) | - | 765860..766477 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| DQL05_RS03975 (NCTC12066_00788) | - | 766487..766762 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQL05_RS03980 (NCTC12066_00789) | - | 766759..766986 (+) | 228 | WP_000609113.1 | phage holin | - |
| DQL05_RS03985 (NCTC12066_00790) | - | 767102..768310 (+) | 1209 | WP_023609806.1 | glucosaminidase domain-containing protein | - |
| DQL05_RS03990 (NCTC12066_00791) | - | 768448..769572 (+) | 1125 | WP_023609814.1 | Fic family protein | - |
| DQL05_RS03995 (NCTC12066_00792) | entC3 | 769785..770567 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| DQL05_RS04000 (NCTC12066_00793) | prx | 770680..770868 (+) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| DQL05_RS04010 (NCTC12066_00795) | - | 771459..772073 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQL05_RS04015 (NCTC12066_00796) | - | 772204..772989 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
| DQL05_RS04020 (NCTC12066_00797) | - | 772999..773697 (-) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DQL05_RS04025 (NCTC12066_00798) | - | 773697..774068 (-) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DQL05_RS04030 (NCTC12066_00799) | - | 774253..777363 (+) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| DQL05_RS04035 (NCTC12066_00800) | pfkA | 777443..778456 (+) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1136424 DQL05_RS04000 WP_011054546.1 770680..770868(+) (prx) [Streptococcus pyogenes strain NCTC12066]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1136424 DQL05_RS04000 WP_011054546.1 770680..770868(+) (prx) [Streptococcus pyogenes strain NCTC12066]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |