Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL06_RS05600 | Genome accession | NZ_LS483321 |
| Coordinates | 1078711..1078899 (-) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain NCTC8314 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1078711..1125861 | 1078711..1078899 | within | 0 |
Gene organization within MGE regions
Location: 1078711..1125861
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL06_RS05600 (NCTC8314_01124) | prx | 1078711..1078899 (-) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| DQL06_RS05605 (NCTC8314_01125) | sda3 | 1079137..1079937 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQL06_RS05615 (NCTC8314_01127) | - | 1080713..1081372 (-) | 660 | WP_011528570.1 | hypothetical protein | - |
| DQL06_RS05620 (NCTC8314_01128) | - | 1081372..1081593 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQL06_RS05625 (NCTC8314_01129) | - | 1081603..1082376 (-) | 774 | WP_011528569.1 | hypothetical protein | - |
| DQL06_RS05630 (NCTC8314_01130) | - | 1082387..1082989 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQL06_RS05635 (NCTC8314_01131) | - | 1083001..1083765 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQL06_RS05640 (NCTC8314_01132) | - | 1083767..1084099 (-) | 333 | WP_011054798.1 | phage holin | - |
| DQL06_RS05645 (NCTC8314_01133) | - | 1084099..1084422 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQL06_RS09830 (NCTC8314_01134) | - | 1084436..1084558 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQL06_RS05650 (NCTC8314_01135) | - | 1084572..1084919 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQL06_RS05655 | - | 1084930..1086791 (-) | 1862 | Protein_1037 | DUF859 family phage minor structural protein | - |
| DQL06_RS09935 (NCTC8314_01137) | - | 1086796..1087380 (-) | 585 | WP_415245000.1 | hypothetical protein | - |
| DQL06_RS09940 (NCTC8314_01138) | - | 1087716..1088546 (-) | 831 | WP_415245001.1 | hypothetical protein | - |
| DQL06_RS09945 (NCTC8314_01139) | - | 1088564..1090243 (-) | 1680 | WP_415245002.1 | glucosaminidase domain-containing protein | - |
| DQL06_RS05665 (NCTC8314_01140) | - | 1090244..1091728 (-) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| DQL06_RS05670 (NCTC8314_01141) | - | 1091729..1093534 (-) | 1806 | WP_011528565.1 | tail protein | - |
| DQL06_RS05675 (NCTC8314_01142) | - | 1093527..1093985 (-) | 459 | WP_011528564.1 | hypothetical protein | - |
| DQL06_RS05680 (NCTC8314_01143) | - | 1093958..1094275 (-) | 318 | WP_111689470.1 | hypothetical protein | - |
| DQL06_RS05685 (NCTC8314_01144) | - | 1094288..1094794 (-) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| DQL06_RS05690 (NCTC8314_01145) | - | 1094806..1095216 (-) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| DQL06_RS05695 (NCTC8314_01146) | - | 1095218..1095613 (-) | 396 | WP_011528560.1 | hypothetical protein | - |
| DQL06_RS05700 (NCTC8314_01147) | - | 1095610..1095921 (-) | 312 | WP_011528559.1 | hypothetical protein | - |
| DQL06_RS05705 (NCTC8314_01148) | - | 1095918..1096262 (-) | 345 | WP_011528558.1 | hypothetical protein | - |
| DQL06_RS05710 (NCTC8314_01149) | - | 1096276..1096569 (-) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| DQL06_RS05715 (NCTC8314_01150) | - | 1096581..1097471 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQL06_RS05720 (NCTC8314_01151) | - | 1097490..1098059 (-) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| DQL06_RS05725 (NCTC8314_01152) | - | 1098171..1098401 (-) | 231 | WP_011528554.1 | hypothetical protein | - |
| DQL06_RS05730 (NCTC8314_01153) | - | 1098408..1099316 (-) | 909 | WP_011528553.1 | minor capsid protein | - |
| DQL06_RS05735 (NCTC8314_01154) | - | 1099285..1100610 (-) | 1326 | WP_011528552.1 | phage portal protein | - |
| DQL06_RS05740 (NCTC8314_01155) | - | 1100610..1101884 (-) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| DQL06_RS05745 (NCTC8314_01156) | - | 1101874..1102254 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQL06_RS05750 (NCTC8314_01157) | - | 1102601..1103041 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL06_RS09650 (NCTC8314_01158) | - | 1103315..1103485 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| DQL06_RS05755 (NCTC8314_01159) | - | 1103482..1103988 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DQL06_RS09655 (NCTC8314_01160) | - | 1103985..1104155 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| DQL06_RS05760 (NCTC8314_01161) | - | 1104152..1104556 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| DQL06_RS05765 (NCTC8314_01162) | - | 1104566..1104835 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQL06_RS05770 (NCTC8314_01163) | - | 1104832..1105116 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| DQL06_RS09880 (NCTC8314_01164) | - | 1105110..1105361 (-) | 252 | WP_011528549.1 | hypothetical protein | - |
| DQL06_RS05780 (NCTC8314_01165) | - | 1105358..1105714 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQL06_RS05785 (NCTC8314_01166) | - | 1105698..1106018 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| DQL06_RS05790 (NCTC8314_01167) | - | 1106263..1107744 (-) | 1482 | WP_020905118.1 | DNA primase family protein | - |
| DQL06_RS05795 (NCTC8314_01168) | - | 1107734..1108546 (-) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| DQL06_RS05800 (NCTC8314_01169) | - | 1108549..1109007 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| DQL06_RS05805 (NCTC8314_01170) | - | 1109023..1110252 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| DQL06_RS05810 (NCTC8314_01171) | - | 1110354..1111034 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQL06_RS05815 (NCTC8314_01172) | - | 1111035..1111517 (-) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| DQL06_RS05820 (NCTC8314_01173) | - | 1111744..1112058 (-) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| DQL06_RS09835 (NCTC8314_01174) | - | 1112074..1112208 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| DQL06_RS05825 (NCTC8314_01175) | - | 1112239..1112490 (-) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| DQL06_RS05830 (NCTC8314_01176) | - | 1112585..1112803 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQL06_RS05835 (NCTC8314_01177) | - | 1112992..1113351 (+) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| DQL06_RS05840 (NCTC8314_01178) | - | 1113335..1113712 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL06_RS09660 (NCTC8314_01179) | - | 1113723..1113875 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| DQL06_RS05845 (NCTC8314_01180) | - | 1114046..1114732 (+) | 687 | WP_011528539.1 | hypothetical protein | - |
| DQL06_RS05850 (NCTC8314_01181) | - | 1114854..1115993 (+) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| DQL06_RS05855 (NCTC8314_01182) | rfbB | 1116076..1117116 (-) | 1041 | WP_023612000.1 | dTDP-glucose 4,6-dehydratase | - |
| DQL06_RS05860 (NCTC8314_01183) | - | 1117360..1117953 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| DQL06_RS05865 (NCTC8314_01184) | rfbA | 1117953..1118822 (-) | 870 | WP_014407521.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| DQL06_RS05870 (NCTC8314_01185) | - | 1118880..1119989 (-) | 1110 | WP_030125977.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| DQL06_RS05875 (NCTC8314_01186) | - | 1120029..1120817 (-) | 789 | WP_002984887.1 | Nif3-like dinuclear metal center hexameric protein | - |
| DQL06_RS05880 (NCTC8314_01187) | - | 1120807..1121493 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| DQL06_RS05885 (NCTC8314_01188) | nth | 1121565..1122221 (-) | 657 | WP_002990106.1 | endonuclease III | - |
| DQL06_RS05890 (NCTC8314_01189) | - | 1122218..1122901 (-) | 684 | WP_002984890.1 | DnaD domain-containing protein | - |
| DQL06_RS05895 (NCTC8314_01190) | - | 1122982..1123500 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| DQL06_RS05900 (NCTC8314_01191) | recJ | 1123651..1125861 (-) | 2211 | WP_030125978.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=1136369 DQL06_RS05600 WP_011528571.1 1078711..1078899(-) (prx) [Streptococcus pyogenes strain NCTC8314]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=1136369 DQL06_RS05600 WP_011528571.1 1078711..1078899(-) (prx) [Streptococcus pyogenes strain NCTC8314]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |