Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL06_RS03785 | Genome accession | NZ_LS483321 |
| Coordinates | 704380..704562 (+) | Length | 60 a.a. |
| NCBI ID | WP_111677352.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8314 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 668634..704562 | 704380..704562 | within | 0 |
Gene organization within MGE regions
Location: 668634..704562
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL06_RS03500 (NCTC8314_00697) | - | 668652..669494 (+) | 843 | WP_032460551.1 | SGNH/GDSL hydrolase family protein | - |
| DQL06_RS03505 (NCTC8314_00698) | - | 669472..670059 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQL06_RS03510 (NCTC8314_00699) | - | 670158..670433 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL06_RS03515 (NCTC8314_00700) | - | 670523..671665 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL06_RS03520 (NCTC8314_00701) | - | 671792..672310 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQL06_RS03525 (NCTC8314_00702) | - | 672322..673077 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQL06_RS03530 (NCTC8314_00703) | - | 673279..673491 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQL06_RS03535 (NCTC8314_00705) | - | 673660..673842 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| DQL06_RS03540 (NCTC8314_00706) | - | 673948..674259 (+) | 312 | WP_063632990.1 | hypothetical protein | - |
| DQL06_RS03545 (NCTC8314_00707) | - | 674261..674446 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQL06_RS09730 | - | 674540..674809 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQL06_RS03555 (NCTC8314_00708) | - | 674950..675336 (+) | 387 | WP_023079927.1 | DnaD domain-containing protein | - |
| DQL06_RS03560 (NCTC8314_00709) | - | 675317..675550 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| DQL06_RS03565 (NCTC8314_00710) | - | 675547..675687 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| DQL06_RS03570 (NCTC8314_00711) | - | 675696..675902 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| DQL06_RS03575 (NCTC8314_00712) | - | 675958..676287 (+) | 330 | WP_032463369.1 | hypothetical protein | - |
| DQL06_RS03580 (NCTC8314_00713) | - | 676290..677219 (+) | 930 | WP_111689516.1 | recombinase RecT | - |
| DQL06_RS03585 (NCTC8314_00714) | - | 677216..678013 (+) | 798 | WP_111689517.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQL06_RS03590 (NCTC8314_00715) | - | 678367..678708 (+) | 342 | WP_000435056.1 | hypothetical protein | - |
| DQL06_RS03595 (NCTC8314_00716) | - | 678705..679217 (+) | 513 | WP_111689518.1 | hypothetical protein | - |
| DQL06_RS03600 (NCTC8314_00717) | - | 679204..679389 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| DQL06_RS03605 (NCTC8314_00718) | - | 679394..679663 (+) | 270 | WP_111689519.1 | hypothetical protein | - |
| DQL06_RS03610 (NCTC8314_00719) | - | 679666..680001 (+) | 336 | WP_111689520.1 | hypothetical protein | - |
| DQL06_RS09610 (NCTC8314_00720) | - | 680081..680245 (+) | 165 | WP_168391735.1 | hypothetical protein | - |
| DQL06_RS03615 (NCTC8314_00721) | - | 680242..680469 (+) | 228 | WP_111689521.1 | hypothetical protein | - |
| DQL06_RS03620 (NCTC8314_00722) | - | 680494..680679 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| DQL06_RS03625 (NCTC8314_00723) | - | 680676..680969 (+) | 294 | WP_032461639.1 | hypothetical protein | - |
| DQL06_RS03630 (NCTC8314_00725) | - | 681362..681781 (+) | 420 | WP_111684753.1 | DUF1492 domain-containing protein | - |
| DQL06_RS03635 | - | 681888..682232 (+) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| DQL06_RS03640 (NCTC8314_00726) | - | 682381..682737 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQL06_RS03645 (NCTC8314_00727) | - | 682734..684002 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| DQL06_RS03650 (NCTC8314_00728) | - | 683995..685488 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| DQL06_RS03655 (NCTC8314_00729) | - | 685494..685718 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQL06_RS03660 (NCTC8314_00730) | - | 685768..685947 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| DQL06_RS03665 (NCTC8314_00731) | - | 685940..686206 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| DQL06_RS03670 (NCTC8314_00732) | - | 686208..686444 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| DQL06_RS03675 (NCTC8314_00733) | - | 686526..687941 (+) | 1416 | WP_011285619.1 | terminase | - |
| DQL06_RS03680 (NCTC8314_00734) | - | 688022..688483 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQL06_RS03685 (NCTC8314_00735) | - | 688508..689419 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| DQL06_RS03690 (NCTC8314_00736) | - | 689419..689619 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQL06_RS03695 (NCTC8314_00737) | - | 689629..690051 (+) | 423 | WP_021733479.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL06_RS03700 (NCTC8314_00738) | - | 690011..690349 (+) | 339 | WP_111689522.1 | hypothetical protein | - |
| DQL06_RS03705 (NCTC8314_00739) | - | 690342..690578 (+) | 237 | WP_111689523.1 | hypothetical protein | - |
| DQL06_RS03710 (NCTC8314_00740) | - | 690579..690914 (+) | 336 | WP_038433474.1 | hypothetical protein | - |
| DQL06_RS03715 (NCTC8314_00741) | - | 690930..691520 (+) | 591 | WP_161230199.1 | phage tail protein | - |
| DQL06_RS03720 (NCTC8314_00742) | - | 691531..691794 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| DQL06_RS03725 (NCTC8314_00743) | - | 691809..692180 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| DQL06_RS03730 (NCTC8314_00744) | - | 692180..694537 (+) | 2358 | WP_111689525.1 | hypothetical protein | - |
| DQL06_RS03735 (NCTC8314_00745) | - | 694534..695229 (+) | 696 | WP_111689526.1 | hypothetical protein | - |
| DQL06_RS03740 (NCTC8314_00746) | - | 695211..697187 (+) | 1977 | WP_161230198.1 | phage tail spike protein | - |
| DQL06_RS03745 (NCTC8314_00747) | - | 697184..698296 (+) | 1113 | WP_111689528.1 | hyaluronoglucosaminidase | - |
| DQL06_RS03750 (NCTC8314_00748) | - | 698306..700087 (+) | 1782 | WP_111689529.1 | gp58-like family protein | - |
| DQL06_RS03755 (NCTC8314_00749) | - | 700096..700524 (+) | 429 | WP_076634202.1 | DUF1617 family protein | - |
| DQL06_RS03760 (NCTC8314_00750) | - | 700527..701159 (+) | 633 | WP_111689530.1 | hypothetical protein | - |
| DQL06_RS03765 (NCTC8314_00751) | - | 701170..701625 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| DQL06_RS03770 (NCTC8314_00753) | - | 701743..702495 (+) | 753 | WP_002993615.1 | CHAP domain-containing protein | - |
| DQL06_RS03775 (NCTC8314_00754) | speC | 702564..703271 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL06_RS03780 (NCTC8314_00755) | mf2 | 703382..704140 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQL06_RS03785 (NCTC8314_00756) | prx | 704380..704562 (+) | 183 | WP_111677352.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7051.01 Da Isoelectric Point: 4.1079
>NTDB_id=1136363 DQL06_RS03785 WP_111677352.1 704380..704562(+) (prx) [Streptococcus pyogenes strain NCTC8314]
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136363 DQL06_RS03785 WP_111677352.1 704380..704562(+) (prx) [Streptococcus pyogenes strain NCTC8314]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |