Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL06_RS02090 | Genome accession | NZ_LS483321 |
| Coordinates | 378634..378816 (+) | Length | 60 a.a. |
| NCBI ID | WP_111689471.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8314 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 317906..381871 | 378634..378816 | within | 0 |
Gene organization within MGE regions
Location: 317906..381871
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL06_RS01730 (NCTC8314_00345) | - | 317906..318802 (-) | 897 | WP_021299026.1 | sulfite exporter TauE/SafE family protein | - |
| DQL06_RS01735 (NCTC8314_00346) | - | 319100..319852 (+) | 753 | WP_111689467.1 | CppA N-terminal domain-containing protein | - |
| DQL06_RS01740 (NCTC8314_00347) | - | 319837..320787 (+) | 951 | WP_011018196.1 | serine hydrolase domain-containing protein | - |
| DQL06_RS01745 (NCTC8314_00348) | pflB | 320967..323294 (-) | 2328 | WP_002988233.1 | formate C-acetyltransferase | - |
| DQL06_RS01750 (NCTC8314_00349) | dinB | 323503..324597 (+) | 1095 | WP_030126288.1 | DNA polymerase IV | - |
| DQL06_RS01755 (NCTC8314_00350) | - | 324690..325172 (-) | 483 | WP_002983066.1 | hypothetical protein | - |
| DQL06_RS01760 (NCTC8314_00351) | - | 325263..327716 (-) | 2454 | WP_030126289.1 | ATP-dependent RecD-like DNA helicase | - |
| DQL06_RS01765 (NCTC8314_00352) | lepB | 327774..328367 (-) | 594 | WP_002983074.1 | signal peptidase I | - |
| DQL06_RS01770 (NCTC8314_00353) | rnhC | 328378..329280 (-) | 903 | WP_010922635.1 | ribonuclease HIII | - |
| DQL06_RS01775 (NCTC8314_00354) | - | 329437..329745 (+) | 309 | WP_002993251.1 | hypothetical protein | - |
| DQL06_RS01780 (NCTC8314_00355) | - | 329748..330293 (+) | 546 | WP_002983087.1 | CvpA family protein | - |
| DQL06_RS01785 (NCTC8314_00356) | - | 330442..332781 (+) | 2340 | WP_111689468.1 | endonuclease MutS2 | - |
| DQL06_RS01790 (NCTC8314_00357) | - | 332785..333285 (+) | 501 | WP_015055998.1 | phosphatase PAP2 family protein | - |
| DQL06_RS01795 (NCTC8314_00358) | trxA | 333348..333680 (+) | 333 | WP_001932060.1 | thioredoxin | - |
| DQL06_RS01800 (NCTC8314_00359) | - | 333732..334313 (-) | 582 | WP_030126292.1 | helix-turn-helix domain-containing protein | - |
| DQL06_RS01805 (NCTC8314_00360) | mutY | 334389..335543 (-) | 1155 | WP_168432791.1 | A/G-specific adenine glycosylase | - |
| DQL06_RS01810 (NCTC8314_00361) | - | 335711..336004 (+) | 294 | WP_002983113.1 | hypothetical protein | - |
| DQL06_RS01815 (NCTC8314_00362) | rpsF | 336177..336467 (+) | 291 | WP_002983117.1 | 30S ribosomal protein S6 | - |
| DQL06_RS01820 (NCTC8314_00363) | ssbA | 336489..336980 (+) | 492 | WP_002993238.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL06_RS01825 (NCTC8314_00364) | rpsR | 337145..337384 (+) | 240 | WP_002983142.1 | 30S ribosomal protein S18 | - |
| DQL06_RS01830 (NCTC8314_00365) | - | 337515..338171 (-) | 657 | WP_002983144.1 | DUF1129 domain-containing protein | - |
| DQL06_RS01835 (NCTC8314_00366) | - | 338304..339248 (-) | 945 | WP_030126295.1 | magnesium transporter CorA family protein | - |
| DQL06_RS01840 (NCTC8314_00367) | - | 339492..340589 (-) | 1098 | WP_047149517.1 | site-specific integrase | - |
| DQL06_RS01845 (NCTC8314_00368) | - | 340765..341316 (-) | 552 | WP_047149516.1 | hypothetical protein | - |
| DQL06_RS01850 (NCTC8314_00369) | - | 341327..341710 (-) | 384 | WP_047149515.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL06_RS01855 (NCTC8314_00370) | - | 341724..342074 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| DQL06_RS01860 (NCTC8314_00371) | - | 342715..342906 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| DQL06_RS01865 (NCTC8314_00372) | - | 342957..343157 (+) | 201 | WP_227868729.1 | hypothetical protein | - |
| DQL06_RS01870 (NCTC8314_00373) | - | 343245..343502 (+) | 258 | WP_047149513.1 | hypothetical protein | - |
| DQL06_RS01875 (NCTC8314_00374) | - | 343531..343701 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQL06_RS01880 (NCTC8314_00375) | - | 343694..343897 (+) | 204 | WP_047149512.1 | hypothetical protein | - |
| DQL06_RS01885 (NCTC8314_00376) | - | 343894..344280 (+) | 387 | WP_047149511.1 | hypothetical protein | - |
| DQL06_RS01890 (NCTC8314_00378) | - | 344426..344629 (+) | 204 | WP_030127426.1 | hypothetical protein | - |
| DQL06_RS01895 (NCTC8314_00379) | - | 344717..345016 (+) | 300 | WP_030127427.1 | hypothetical protein | - |
| DQL06_RS01900 (NCTC8314_00380) | - | 345016..346173 (+) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| DQL06_RS01905 (NCTC8314_00381) | - | 346182..346745 (+) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| DQL06_RS01910 (NCTC8314_00382) | - | 346788..348710 (+) | 1923 | WP_047149510.1 | DNA polymerase | - |
| DQL06_RS01915 (NCTC8314_00383) | - | 348715..351099 (+) | 2385 | WP_111689469.1 | phage/plasmid primase, P4 family | - |
| DQL06_RS01920 (NCTC8314_00384) | - | 351485..351760 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQL06_RS01925 (NCTC8314_00385) | - | 351757..353079 (+) | 1323 | WP_047149508.1 | SNF2-related protein | - |
| DQL06_RS09590 (NCTC8314_00386) | - | 353080..353250 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| DQL06_RS01930 (NCTC8314_00387) | - | 353243..353515 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQL06_RS01935 (NCTC8314_00389) | - | 353648..354064 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQL06_RS01940 (NCTC8314_00390) | - | 354154..354606 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| DQL06_RS01945 (NCTC8314_00391) | - | 354596..355873 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| DQL06_RS01950 (NCTC8314_00392) | - | 355889..357421 (+) | 1533 | WP_038433243.1 | phage portal protein | - |
| DQL06_RS01955 (NCTC8314_00393) | - | 357381..358829 (+) | 1449 | WP_032465703.1 | minor capsid protein | - |
| DQL06_RS01960 | - | 358857..359045 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| DQL06_RS01965 (NCTC8314_00395) | - | 359050..359316 (+) | 267 | WP_011888934.1 | hypothetical protein | - |
| DQL06_RS01970 (NCTC8314_00396) | - | 359471..360040 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| DQL06_RS01975 (NCTC8314_00397) | - | 360059..360949 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQL06_RS01980 (NCTC8314_00398) | - | 360961..361254 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| DQL06_RS01985 (NCTC8314_00399) | - | 361268..361612 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| DQL06_RS01990 (NCTC8314_00400) | - | 361609..361920 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| DQL06_RS01995 (NCTC8314_00401) | - | 361917..362312 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| DQL06_RS02000 (NCTC8314_00402) | - | 362314..362724 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| DQL06_RS02005 (NCTC8314_00403) | - | 362736..363242 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| DQL06_RS02010 (NCTC8314_00404) | - | 363255..363572 (+) | 318 | WP_111689470.1 | hypothetical protein | - |
| DQL06_RS02015 (NCTC8314_00405) | - | 363545..364003 (+) | 459 | WP_011528564.1 | hypothetical protein | - |
| DQL06_RS02020 (NCTC8314_00406) | - | 363996..365801 (+) | 1806 | WP_011528565.1 | tail protein | - |
| DQL06_RS02025 (NCTC8314_00407) | - | 365802..367286 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| DQL06_RS02030 (NCTC8314_00408) | - | 367287..370736 (+) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| DQL06_RS02035 (NCTC8314_00409) | - | 370741..372603 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| DQL06_RS02040 (NCTC8314_00410) | - | 372614..372961 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQL06_RS09815 (NCTC8314_00411) | - | 372975..373097 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQL06_RS02045 (NCTC8314_00412) | - | 373111..373434 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQL06_RS02050 (NCTC8314_00413) | - | 373434..373766 (+) | 333 | WP_011054798.1 | phage holin | - |
| DQL06_RS02055 (NCTC8314_00414) | - | 373768..374532 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQL06_RS02060 (NCTC8314_00415) | - | 374544..375146 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQL06_RS02065 (NCTC8314_00416) | - | 375157..375930 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| DQL06_RS02070 (NCTC8314_00417) | - | 375940..376161 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQL06_RS02075 (NCTC8314_00418) | - | 376161..376820 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| DQL06_RS02085 (NCTC8314_00420) | sda3 | 377596..378396 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQL06_RS02090 (NCTC8314_00421) | prx | 378634..378816 (+) | 183 | WP_111689471.1 | Paratox | Regulator |
| DQL06_RS02095 (NCTC8314_00422) | uvrA | 379043..381871 (+) | 2829 | WP_111689472.1 | excinuclease ABC subunit UvrA | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6980.05 Da Isoelectric Point: 4.0548
>NTDB_id=1136354 DQL06_RS02090 WP_111689471.1 378634..378816(+) (prx) [Streptococcus pyogenes strain NCTC8314]
MLTYDEFKQAIDREYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVMVELDK
MLTYDEFKQAIDREYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136354 DQL06_RS02090 WP_111689471.1 378634..378816(+) (prx) [Streptococcus pyogenes strain NCTC8314]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |