Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL31_RS07140 | Genome accession | NZ_LS483320 |
| Coordinates | 1353090..1353272 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain NCTC5164 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1353090..1391866 | 1353090..1353272 | within | 0 |
Gene organization within MGE regions
Location: 1353090..1391866
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL31_RS07140 (NCTC5164_01437) | prx | 1353090..1353272 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| DQL31_RS07145 (NCTC5164_01438) | speA | 1353493..1354248 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DQL31_RS07150 (NCTC5164_01439) | - | 1354370..1355029 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| DQL31_RS07155 (NCTC5164_01440) | - | 1355029..1355250 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQL31_RS07160 (NCTC5164_01441) | - | 1355260..1356033 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| DQL31_RS07165 (NCTC5164_01442) | - | 1356044..1356646 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQL31_RS07170 (NCTC5164_01443) | - | 1356658..1357422 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQL31_RS07175 (NCTC5164_01444) | - | 1357424..1357756 (-) | 333 | WP_011054798.1 | phage holin | - |
| DQL31_RS07180 (NCTC5164_01445) | - | 1357756..1358079 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQL31_RS10445 (NCTC5164_01446) | - | 1358093..1358215 (-) | 123 | WP_269458599.1 | hypothetical protein | - |
| DQL31_RS07185 (NCTC5164_01447) | - | 1358229..1358576 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQL31_RS07190 (NCTC5164_01448) | - | 1358587..1360449 (-) | 1863 | WP_111677394.1 | DUF859 family phage minor structural protein | - |
| DQL31_RS07195 (NCTC5164_01449) | - | 1360454..1363894 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| DQL31_RS07200 (NCTC5164_01450) | - | 1363895..1365379 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DQL31_RS07205 (NCTC5164_01451) | - | 1365380..1367186 (-) | 1807 | Protein_1369 | phage tail protein | - |
| DQL31_RS07210 (NCTC5164_01453) | - | 1367179..1367637 (-) | 459 | WP_111677395.1 | hypothetical protein | - |
| DQL31_RS07215 (NCTC5164_01454) | - | 1367610..1367927 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| DQL31_RS07220 (NCTC5164_01455) | - | 1367940..1368446 (-) | 507 | WP_111677396.1 | phage major tail protein, TP901-1 family | - |
| DQL31_RS07225 (NCTC5164_01456) | - | 1368458..1368868 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DQL31_RS07230 (NCTC5164_01457) | - | 1368870..1369265 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| DQL31_RS07235 (NCTC5164_01458) | - | 1369262..1369573 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| DQL31_RS07240 (NCTC5164_01459) | - | 1369570..1369914 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| DQL31_RS07245 (NCTC5164_01460) | - | 1369928..1370221 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DQL31_RS07250 (NCTC5164_01461) | - | 1370234..1371124 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQL31_RS07255 (NCTC5164_01462) | - | 1371142..1371714 (-) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| DQL31_RS07260 (NCTC5164_01463) | - | 1371864..1372130 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| DQL31_RS07265 (NCTC5164_01464) | - | 1372137..1373045 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| DQL31_RS07270 (NCTC5164_01465) | - | 1373014..1374339 (-) | 1326 | WP_009880265.1 | phage portal protein | - |
| DQL31_RS07275 (NCTC5164_01466) | - | 1374339..1375613 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| DQL31_RS07280 (NCTC5164_01467) | - | 1375603..1375983 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQL31_RS07285 (NCTC5164_01468) | - | 1376593..1377027 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL31_RS10175 (NCTC5164_01469) | - | 1377312..1377482 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| DQL31_RS07290 (NCTC5164_01470) | - | 1377479..1377982 (-) | 504 | WP_111677397.1 | DUF1642 domain-containing protein | - |
| DQL31_RS07295 (NCTC5164_01471) | - | 1378269..1378454 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| DQL31_RS07300 (NCTC5164_01472) | - | 1378620..1378955 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| DQL31_RS07305 (NCTC5164_01473) | - | 1378958..1379242 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| DQL31_RS10180 (NCTC5164_01474) | - | 1379239..1379409 (-) | 171 | WP_011054814.1 | hypothetical protein | - |
| DQL31_RS07310 (NCTC5164_01475) | - | 1379406..1379819 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| DQL31_RS07315 (NCTC5164_01476) | - | 1379816..1380100 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| DQL31_RS10500 (NCTC5164_01477) | - | 1380094..1380345 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| DQL31_RS07325 (NCTC5164_01478) | - | 1380342..1380698 (-) | 357 | WP_111677398.1 | hypothetical protein | - |
| DQL31_RS07330 (NCTC5164_01479) | - | 1380682..1381002 (-) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| DQL31_RS07335 (NCTC5164_01480) | - | 1381148..1382011 (-) | 864 | WP_002987985.1 | IS982-like element ISSpy2 family transposase | - |
| DQL31_RS07345 (NCTC5164_01481) | - | 1382216..1383697 (-) | 1482 | WP_023611301.1 | DNA primase family protein | - |
| DQL31_RS07350 (NCTC5164_01482) | - | 1383687..1384499 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DQL31_RS07355 (NCTC5164_01483) | - | 1384502..1384960 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQL31_RS07360 (NCTC5164_01484) | - | 1384975..1386204 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DQL31_RS07365 (NCTC5164_01485) | - | 1386306..1386986 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQL31_RS07370 (NCTC5164_01486) | - | 1386987..1387469 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQL31_RS07375 (NCTC5164_01487) | - | 1387617..1387931 (-) | 315 | WP_063812425.1 | helix-turn-helix domain-containing protein | - |
| DQL31_RS10185 (NCTC5164_01488) | - | 1387947..1388084 (-) | 138 | WP_011054821.1 | hypothetical protein | - |
| DQL31_RS07380 (NCTC5164_01489) | - | 1388115..1388366 (-) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| DQL31_RS07385 (NCTC5164_01490) | - | 1388461..1388679 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQL31_RS07390 (NCTC5164_01491) | - | 1388868..1389227 (+) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| DQL31_RS07395 (NCTC5164_01492) | - | 1389211..1389588 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL31_RS10190 (NCTC5164_01493) | - | 1389599..1389751 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| DQL31_RS07400 (NCTC5164_01494) | - | 1389922..1390608 (+) | 687 | WP_043885029.1 | hypothetical protein | - |
| DQL31_RS10340 (NCTC5164_01495) | - | 1390782..1391450 (+) | 669 | WP_231871137.1 | phage integrase SAM-like domain-containing protein | - |
| DQL31_RS10345 (NCTC5164_01496) | - | 1391474..1391866 (+) | 393 | WP_231871138.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=1136318 DQL31_RS07140 WP_011054793.1 1353090..1353272(-) (prx) [Streptococcus pyogenes strain NCTC5164]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136318 DQL31_RS07140 WP_011054793.1 1353090..1353272(-) (prx) [Streptococcus pyogenes strain NCTC5164]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |