Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL31_RS06375 | Genome accession | NZ_LS483320 |
| Coordinates | 1207432..1207614 (-) | Length | 60 a.a. |
| NCBI ID | WP_111677352.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC5164 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1207432..1249176 | 1207432..1207614 | within | 0 |
Gene organization within MGE regions
Location: 1207432..1249176
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL31_RS06375 (NCTC5164_01278) | prx | 1207432..1207614 (-) | 183 | WP_111677352.1 | Paratox | Regulator |
| DQL31_RS06380 (NCTC5164_01279) | mf2 | 1207854..1208612 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQL31_RS06385 (NCTC5164_01280) | speC | 1208723..1209430 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL31_RS06390 (NCTC5164_01281) | - | 1209499..1210251 (-) | 753 | WP_002993615.1 | CHAP domain-containing protein | - |
| DQL31_RS06395 (NCTC5164_01283) | - | 1210369..1210824 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| DQL31_RS06400 (NCTC5164_01284) | - | 1210835..1211473 (-) | 639 | WP_023610893.1 | hypothetical protein | - |
| DQL31_RS06405 (NCTC5164_01285) | - | 1211476..1211904 (-) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| DQL31_RS06410 (NCTC5164_01286) | - | 1211916..1213802 (-) | 1887 | WP_014411851.1 | gp58-like family protein | - |
| DQL31_RS06415 (NCTC5164_01287) | hylP | 1213815..1214837 (-) | 1023 | WP_014411852.1 | hyaluronidase HylP | - |
| DQL31_RS06420 (NCTC5164_01288) | - | 1214834..1216978 (-) | 2145 | WP_111677353.1 | phage tail spike protein | - |
| DQL31_RS06425 (NCTC5164_01289) | - | 1216975..1217682 (-) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| DQL31_RS06430 (NCTC5164_01290) | - | 1217682..1221605 (-) | 3924 | WP_014411855.1 | phage tail tape measure protein | - |
| DQL31_RS10145 (NCTC5164_01291) | - | 1221618..1221785 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| DQL31_RS06435 (NCTC5164_01292) | gpG | 1221815..1222141 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| DQL31_RS06440 (NCTC5164_01293) | - | 1222194..1222802 (-) | 609 | WP_014411858.1 | major tail protein | - |
| DQL31_RS06445 (NCTC5164_01294) | - | 1222819..1223244 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| DQL31_RS06450 (NCTC5164_01295) | - | 1223241..1223618 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL31_RS06455 (NCTC5164_01296) | - | 1223615..1223962 (-) | 348 | WP_002985351.1 | phage head closure protein | - |
| DQL31_RS06460 (NCTC5164_01297) | - | 1223959..1224261 (-) | 303 | WP_014411860.1 | head-tail connector protein | - |
| DQL31_RS10150 | - | 1224264..1224410 (-) | 147 | WP_023610896.1 | hypothetical protein | - |
| DQL31_RS06465 (NCTC5164_01298) | - | 1224397..1225599 (-) | 1203 | WP_014411862.1 | phage major capsid protein | - |
| DQL31_RS06470 (NCTC5164_01299) | - | 1225625..1226290 (-) | 666 | WP_023610933.1 | head maturation protease, ClpP-related | - |
| DQL31_RS06475 (NCTC5164_01300) | - | 1226268..1227488 (-) | 1221 | WP_014411863.1 | phage portal protein | - |
| DQL31_RS06480 (NCTC5164_01301) | - | 1227522..1227746 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQL31_RS10155 (NCTC5164_01302) | - | 1227739..1227909 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQL31_RS06485 (NCTC5164_01303) | - | 1227906..1229660 (-) | 1755 | WP_014411864.1 | terminase large subunit | - |
| DQL31_RS06490 (NCTC5164_01304) | - | 1229675..1230142 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQL31_RS06495 (NCTC5164_01305) | - | 1230313..1230651 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQL31_RS06505 (NCTC5164_01306) | - | 1231236..1231676 (-) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL31_RS06510 (NCTC5164_01307) | - | 1231952..1232323 (-) | 372 | WP_014411868.1 | hypothetical protein | - |
| DQL31_RS06515 (NCTC5164_01308) | - | 1232320..1233030 (-) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DQL31_RS06520 (NCTC5164_01309) | - | 1233033..1233665 (-) | 633 | WP_111677354.1 | N-6 DNA methylase | - |
| DQL31_RS06525 (NCTC5164_01310) | - | 1233667..1233951 (-) | 285 | WP_014411870.1 | hypothetical protein | - |
| DQL31_RS06530 (NCTC5164_01311) | - | 1233948..1234352 (-) | 405 | WP_014411871.1 | YopX family protein | - |
| DQL31_RS06535 (NCTC5164_01312) | - | 1234362..1234631 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQL31_RS06540 (NCTC5164_01313) | - | 1234628..1234912 (-) | 285 | WP_014411872.1 | DUF3310 domain-containing protein | - |
| DQL31_RS10495 (NCTC5164_01314) | - | 1234906..1235146 (-) | 241 | Protein_1237 | hypothetical protein | - |
| DQL31_RS06550 (NCTC5164_01315) | - | 1235143..1235499 (-) | 357 | WP_111677355.1 | hypothetical protein | - |
| DQL31_RS06555 (NCTC5164_01316) | - | 1235483..1235803 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| DQL31_RS06560 (NCTC5164_01317) | - | 1235800..1236213 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| DQL31_RS06565 (NCTC5164_01318) | - | 1236475..1237950 (-) | 1476 | WP_111677356.1 | DNA primase family protein | - |
| DQL31_RS06570 (NCTC5164_01319) | - | 1237940..1238752 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DQL31_RS06575 (NCTC5164_01320) | - | 1238755..1239213 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQL31_RS06580 (NCTC5164_01321) | - | 1239228..1240457 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DQL31_RS06585 (NCTC5164_01322) | - | 1240559..1241239 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQL31_RS06590 (NCTC5164_01323) | - | 1241240..1241722 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQL31_RS06595 (NCTC5164_01324) | - | 1241870..1242184 (-) | 315 | WP_063812425.1 | helix-turn-helix domain-containing protein | - |
| DQL31_RS10160 (NCTC5164_01325) | - | 1242200..1242337 (-) | 138 | WP_168390507.1 | hypothetical protein | - |
| DQL31_RS06600 (NCTC5164_01326) | - | 1242339..1242650 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQL31_RS06605 (NCTC5164_01327) | - | 1242728..1242913 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQL31_RS06610 (NCTC5164_01328) | - | 1243080..1243319 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQL31_RS06615 (NCTC5164_01329) | - | 1243470..1243679 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQL31_RS06625 (NCTC5164_01331) | - | 1243932..1244738 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQL31_RS06635 (NCTC5164_01333) | - | 1244950..1245189 (-) | 240 | WP_014411882.1 | helix-turn-helix domain-containing protein | - |
| DQL31_RS06640 (NCTC5164_01334) | - | 1245283..1245882 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQL31_RS06645 (NCTC5164_01335) | - | 1245912..1246070 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| DQL31_RS06650 (NCTC5164_01337) | - | 1246443..1247231 (+) | 789 | WP_014411883.1 | S24 family peptidase | - |
| DQL31_RS06655 (NCTC5164_01338) | - | 1247241..1247546 (+) | 306 | WP_011106738.1 | membrane protein | - |
| DQL31_RS06660 (NCTC5164_01339) | - | 1247669..1248811 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL31_RS06665 (NCTC5164_01340) | - | 1248901..1249176 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7051.01 Da Isoelectric Point: 4.1079
>NTDB_id=1136315 DQL31_RS06375 WP_111677352.1 1207432..1207614(-) (prx) [Streptococcus pyogenes strain NCTC5164]
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136315 DQL31_RS06375 WP_111677352.1 1207432..1207614(-) (prx) [Streptococcus pyogenes strain NCTC5164]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |