Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   DQM44_RS02585 Genome accession   NZ_LS483318
Coordinates   464008..464190 (+) Length   60 a.a.
NCBI ID   WP_111711590.1    Uniprot ID   -
Organism   Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 422954..467108 464008..464190 within 0


Gene organization within MGE regions


Location: 422954..467108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQM44_RS02295 (NCTC5370_00473) - 422954..424120 (-) 1167 WP_111711560.1 site-specific integrase -
  DQM44_RS02300 (NCTC5370_00474) - 424427..425236 (-) 810 WP_111711561.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DQM44_RS02305 (NCTC5370_00475) - 425249..426016 (-) 768 WP_111711562.1 S24 family peptidase -
  DQM44_RS10435 (NCTC5370_00477) - 426400..426537 (+) 138 WP_023078399.1 hypothetical protein -
  DQM44_RS02310 (NCTC5370_00478) - 426517..426897 (-) 381 WP_023078407.1 DUF2513 domain-containing protein -
  DQM44_RS02315 (NCTC5370_00479) - 426956..427114 (+) 159 WP_111711563.1 hypothetical protein -
  DQM44_RS02320 (NCTC5370_00480) - 427145..427744 (-) 600 WP_030127422.1 hypothetical protein -
  DQM44_RS02325 (NCTC5370_00481) - 427797..428003 (+) 207 WP_001157159.1 helix-turn-helix transcriptional regulator -
  DQM44_RS02330 (NCTC5370_00482) - 428043..428759 (+) 717 WP_111711564.1 phage antirepressor KilAC domain-containing protein -
  DQM44_RS02335 (NCTC5370_00483) - 428772..428990 (+) 219 WP_046177738.1 hypothetical protein -
  DQM44_RS10440 (NCTC5370_00484) - 428987..429145 (-) 159 WP_153276795.1 hypothetical protein -
  DQM44_RS02340 (NCTC5370_00485) - 429246..429497 (+) 252 WP_111711713.1 hypothetical protein -
  DQM44_RS10445 (NCTC5370_00486) - 429528..429668 (+) 141 WP_021340647.1 hypothetical protein -
  DQM44_RS02345 (NCTC5370_00487) - 429678..429887 (+) 210 WP_111711565.1 hypothetical protein -
  DQM44_RS02350 (NCTC5370_00488) - 430011..430190 (+) 180 WP_012560974.1 hypothetical protein -
  DQM44_RS02355 (NCTC5370_00489) - 430362..430805 (+) 444 WP_111711566.1 hypothetical protein -
  DQM44_RS02360 (NCTC5370_00490) - 430921..431745 (+) 825 WP_111711567.1 DnaD domain protein -
  DQM44_RS02365 (NCTC5370_00491) - 431726..431959 (+) 234 WP_111711568.1 hypothetical protein -
  DQM44_RS02370 (NCTC5370_00492) - 431956..432096 (+) 141 WP_011284979.1 hypothetical protein -
  DQM44_RS02375 (NCTC5370_00493) - 432105..432311 (+) 207 WP_046176837.1 hypothetical protein -
  DQM44_RS02380 (NCTC5370_00494) - 432473..432955 (+) 483 WP_046176835.1 siphovirus Gp157 family protein -
  DQM44_RS02385 (NCTC5370_00495) - 432956..433630 (+) 675 WP_111711569.1 ERF family protein -
  DQM44_RS02390 (NCTC5370_00496) ssbA 433623..434015 (+) 393 WP_111711570.1 single-stranded DNA-binding protein Machinery gene
  DQM44_RS02395 (NCTC5370_00497) - 434030..434308 (+) 279 WP_022554788.1 hypothetical protein -
  DQM44_RS02400 (NCTC5370_00498) - 434323..434508 (+) 186 WP_111711571.1 hypothetical protein -
  DQM44_RS02405 (NCTC5370_00499) - 434505..434774 (+) 270 WP_003059068.1 hypothetical protein -
  DQM44_RS02410 (NCTC5370_00500) - 434784..435068 (+) 285 WP_111711572.1 hypothetical protein -
  DQM44_RS02415 (NCTC5370_00501) - 435069..435974 (+) 906 WP_111711573.1 N-6 DNA methylase -
  DQM44_RS02420 (NCTC5370_00502) - 435971..436642 (+) 672 WP_111711574.1 hypothetical protein -
  DQM44_RS02425 (NCTC5370_00503) - 436643..437368 (+) 726 WP_111711575.1 helix-turn-helix domain-containing protein -
  DQM44_RS10580 - 437371..437487 (+) 117 Protein_430 SAM-dependent methyltransferase -
  DQM44_RS02435 (NCTC5370_00504) - 437614..438054 (+) 441 WP_111711576.1 ArpU family phage packaging/lysis transcriptional regulator -
  DQM44_RS02440 (NCTC5370_00505) - 438560..439036 (+) 477 WP_111711577.1 terminase small subunit -
  DQM44_RS02445 (NCTC5370_00506) - 439039..440325 (+) 1287 WP_030127707.1 PBSX family phage terminase large subunit -
  DQM44_RS02450 (NCTC5370_00507) - 440339..441841 (+) 1503 WP_111711578.1 phage portal protein -
  DQM44_RS02455 (NCTC5370_00508) - 441846..443342 (+) 1497 WP_111711579.1 phage minor capsid protein -
  DQM44_RS02460 (NCTC5370_00509) - 443339..443566 (+) 228 WP_111679809.1 hypothetical protein -
  DQM44_RS02465 - 443640..443906 (+) 267 Protein_437 hypothetical protein -
  DQM44_RS02470 (NCTC5370_00511) - 444044..444658 (+) 615 WP_111711580.1 hypothetical protein -
  DQM44_RS02475 (NCTC5370_00512) - 444662..445480 (+) 819 WP_111679812.1 N4-gp56 family major capsid protein -
  DQM44_RS02480 (NCTC5370_00513) - 445534..445950 (+) 417 WP_111679813.1 hypothetical protein -
  DQM44_RS02485 (NCTC5370_00514) - 445940..446272 (+) 333 WP_111679814.1 minor capsid protein -
  DQM44_RS02490 (NCTC5370_00515) - 446272..446628 (+) 357 WP_111679815.1 minor capsid protein -
  DQM44_RS02495 (NCTC5370_00516) - 446625..447023 (+) 399 WP_111679816.1 minor capsid protein -
  DQM44_RS02500 (NCTC5370_00517) - 447023..447508 (+) 486 WP_111711581.1 phage tail protein -
  DQM44_RS02505 (NCTC5370_00518) - 447554..447988 (+) 435 WP_111711582.1 hypothetical protein -
  DQM44_RS02510 (NCTC5370_00519) - 447997..448578 (+) 582 WP_111679819.1 bacteriophage Gp15 family protein -
  DQM44_RS02515 (NCTC5370_00520) - 448568..451828 (+) 3261 WP_111711583.1 tape measure protein -
  DQM44_RS02520 (NCTC5370_00521) - 451825..452541 (+) 717 WP_111711584.1 distal tail protein Dit -
  DQM44_RS02525 (NCTC5370_00522) - 452538..454685 (+) 2148 WP_111711585.1 phage tail spike protein -
  DQM44_RS02530 (NCTC5370_00523) - 454682..455737 (+) 1056 WP_065354790.1 hyaluronoglucosaminidase -
  DQM44_RS02535 (NCTC5370_00524) - 455737..456378 (+) 642 WP_111711586.1 hypothetical protein -
  DQM44_RS02540 (NCTC5370_00525) - 456389..458299 (+) 1911 WP_065354792.1 gp58-like family protein -
  DQM44_RS02545 (NCTC5370_00526) - 458312..458743 (+) 432 WP_003055326.1 DUF1617 family protein -
  DQM44_RS02550 (NCTC5370_00527) - 458746..459354 (+) 609 WP_065354793.1 DUF1366 domain-containing protein -
  DQM44_RS02555 (NCTC5370_00528) - 459365..459664 (+) 300 WP_023077839.1 hypothetical protein -
  DQM44_RS02560 (NCTC5370_00529) - 459661..459846 (+) 186 WP_011184796.1 holin -
  DQM44_RS02565 (NCTC5370_00531) - 459957..461153 (+) 1197 WP_111711587.1 glucosaminidase domain-containing protein -
  DQM44_RS02570 (NCTC5370_00532) - 461343..461885 (+) 543 WP_032465096.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  DQM44_RS02575 (NCTC5370_00533) - 461889..462725 (+) 837 WP_111711588.1 hypothetical protein -
  DQM44_RS02580 (NCTC5370_00534) - 462786..463775 (-) 990 WP_111711589.1 DNA/RNA non-specific endonuclease -
  DQM44_RS02585 (NCTC5370_00535) prx 464008..464190 (+) 183 WP_111711590.1 Paratox Regulator
  DQM44_RS02590 (NCTC5370_00536) - 464277..466685 (+) 2409 WP_044565581.1 DNA translocase FtsK -
  DQM44_RS02595 (NCTC5370_00537) - 466755..467108 (-) 354 WP_002990803.1 DUF3397 domain-containing protein -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 7013.02 Da        Isoelectric Point: 4.0474

>NTDB_id=1136191 DQM44_RS02585 WP_111711590.1 464008..464190(+) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370]
MLTYDEFKQAIDNGYITADTVMIVRKDGQIFDYVLSGEKVRPWEIVAEEKVEEVLMELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=1136191 DQM44_RS02585 WP_111711590.1 464008..464190(+) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGTCTGGTGAGAAAGTGAGACCGTGGGAGATTGTGGCCGAGGAGAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

83.333

100

0.833

  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS8232

76.667

100

0.767

  prx Streptococcus pyogenes MGAS315

75

100

0.75

  prx Streptococcus pyogenes MGAS315

80.488

68.333

0.55

  prx Streptococcus pyogenes MGAS315

73.171

68.333

0.5


Multiple sequence alignment