Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM44_RS02585 | Genome accession | NZ_LS483318 |
| Coordinates | 464008..464190 (+) | Length | 60 a.a. |
| NCBI ID | WP_111711590.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 422954..467108 | 464008..464190 | within | 0 |
Gene organization within MGE regions
Location: 422954..467108
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM44_RS02295 (NCTC5370_00473) | - | 422954..424120 (-) | 1167 | WP_111711560.1 | site-specific integrase | - |
| DQM44_RS02300 (NCTC5370_00474) | - | 424427..425236 (-) | 810 | WP_111711561.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQM44_RS02305 (NCTC5370_00475) | - | 425249..426016 (-) | 768 | WP_111711562.1 | S24 family peptidase | - |
| DQM44_RS10435 (NCTC5370_00477) | - | 426400..426537 (+) | 138 | WP_023078399.1 | hypothetical protein | - |
| DQM44_RS02310 (NCTC5370_00478) | - | 426517..426897 (-) | 381 | WP_023078407.1 | DUF2513 domain-containing protein | - |
| DQM44_RS02315 (NCTC5370_00479) | - | 426956..427114 (+) | 159 | WP_111711563.1 | hypothetical protein | - |
| DQM44_RS02320 (NCTC5370_00480) | - | 427145..427744 (-) | 600 | WP_030127422.1 | hypothetical protein | - |
| DQM44_RS02325 (NCTC5370_00481) | - | 427797..428003 (+) | 207 | WP_001157159.1 | helix-turn-helix transcriptional regulator | - |
| DQM44_RS02330 (NCTC5370_00482) | - | 428043..428759 (+) | 717 | WP_111711564.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM44_RS02335 (NCTC5370_00483) | - | 428772..428990 (+) | 219 | WP_046177738.1 | hypothetical protein | - |
| DQM44_RS10440 (NCTC5370_00484) | - | 428987..429145 (-) | 159 | WP_153276795.1 | hypothetical protein | - |
| DQM44_RS02340 (NCTC5370_00485) | - | 429246..429497 (+) | 252 | WP_111711713.1 | hypothetical protein | - |
| DQM44_RS10445 (NCTC5370_00486) | - | 429528..429668 (+) | 141 | WP_021340647.1 | hypothetical protein | - |
| DQM44_RS02345 (NCTC5370_00487) | - | 429678..429887 (+) | 210 | WP_111711565.1 | hypothetical protein | - |
| DQM44_RS02350 (NCTC5370_00488) | - | 430011..430190 (+) | 180 | WP_012560974.1 | hypothetical protein | - |
| DQM44_RS02355 (NCTC5370_00489) | - | 430362..430805 (+) | 444 | WP_111711566.1 | hypothetical protein | - |
| DQM44_RS02360 (NCTC5370_00490) | - | 430921..431745 (+) | 825 | WP_111711567.1 | DnaD domain protein | - |
| DQM44_RS02365 (NCTC5370_00491) | - | 431726..431959 (+) | 234 | WP_111711568.1 | hypothetical protein | - |
| DQM44_RS02370 (NCTC5370_00492) | - | 431956..432096 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| DQM44_RS02375 (NCTC5370_00493) | - | 432105..432311 (+) | 207 | WP_046176837.1 | hypothetical protein | - |
| DQM44_RS02380 (NCTC5370_00494) | - | 432473..432955 (+) | 483 | WP_046176835.1 | siphovirus Gp157 family protein | - |
| DQM44_RS02385 (NCTC5370_00495) | - | 432956..433630 (+) | 675 | WP_111711569.1 | ERF family protein | - |
| DQM44_RS02390 (NCTC5370_00496) | ssbA | 433623..434015 (+) | 393 | WP_111711570.1 | single-stranded DNA-binding protein | Machinery gene |
| DQM44_RS02395 (NCTC5370_00497) | - | 434030..434308 (+) | 279 | WP_022554788.1 | hypothetical protein | - |
| DQM44_RS02400 (NCTC5370_00498) | - | 434323..434508 (+) | 186 | WP_111711571.1 | hypothetical protein | - |
| DQM44_RS02405 (NCTC5370_00499) | - | 434505..434774 (+) | 270 | WP_003059068.1 | hypothetical protein | - |
| DQM44_RS02410 (NCTC5370_00500) | - | 434784..435068 (+) | 285 | WP_111711572.1 | hypothetical protein | - |
| DQM44_RS02415 (NCTC5370_00501) | - | 435069..435974 (+) | 906 | WP_111711573.1 | N-6 DNA methylase | - |
| DQM44_RS02420 (NCTC5370_00502) | - | 435971..436642 (+) | 672 | WP_111711574.1 | hypothetical protein | - |
| DQM44_RS02425 (NCTC5370_00503) | - | 436643..437368 (+) | 726 | WP_111711575.1 | helix-turn-helix domain-containing protein | - |
| DQM44_RS10580 | - | 437371..437487 (+) | 117 | Protein_430 | SAM-dependent methyltransferase | - |
| DQM44_RS02435 (NCTC5370_00504) | - | 437614..438054 (+) | 441 | WP_111711576.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM44_RS02440 (NCTC5370_00505) | - | 438560..439036 (+) | 477 | WP_111711577.1 | terminase small subunit | - |
| DQM44_RS02445 (NCTC5370_00506) | - | 439039..440325 (+) | 1287 | WP_030127707.1 | PBSX family phage terminase large subunit | - |
| DQM44_RS02450 (NCTC5370_00507) | - | 440339..441841 (+) | 1503 | WP_111711578.1 | phage portal protein | - |
| DQM44_RS02455 (NCTC5370_00508) | - | 441846..443342 (+) | 1497 | WP_111711579.1 | phage minor capsid protein | - |
| DQM44_RS02460 (NCTC5370_00509) | - | 443339..443566 (+) | 228 | WP_111679809.1 | hypothetical protein | - |
| DQM44_RS02465 | - | 443640..443906 (+) | 267 | Protein_437 | hypothetical protein | - |
| DQM44_RS02470 (NCTC5370_00511) | - | 444044..444658 (+) | 615 | WP_111711580.1 | hypothetical protein | - |
| DQM44_RS02475 (NCTC5370_00512) | - | 444662..445480 (+) | 819 | WP_111679812.1 | N4-gp56 family major capsid protein | - |
| DQM44_RS02480 (NCTC5370_00513) | - | 445534..445950 (+) | 417 | WP_111679813.1 | hypothetical protein | - |
| DQM44_RS02485 (NCTC5370_00514) | - | 445940..446272 (+) | 333 | WP_111679814.1 | minor capsid protein | - |
| DQM44_RS02490 (NCTC5370_00515) | - | 446272..446628 (+) | 357 | WP_111679815.1 | minor capsid protein | - |
| DQM44_RS02495 (NCTC5370_00516) | - | 446625..447023 (+) | 399 | WP_111679816.1 | minor capsid protein | - |
| DQM44_RS02500 (NCTC5370_00517) | - | 447023..447508 (+) | 486 | WP_111711581.1 | phage tail protein | - |
| DQM44_RS02505 (NCTC5370_00518) | - | 447554..447988 (+) | 435 | WP_111711582.1 | hypothetical protein | - |
| DQM44_RS02510 (NCTC5370_00519) | - | 447997..448578 (+) | 582 | WP_111679819.1 | bacteriophage Gp15 family protein | - |
| DQM44_RS02515 (NCTC5370_00520) | - | 448568..451828 (+) | 3261 | WP_111711583.1 | tape measure protein | - |
| DQM44_RS02520 (NCTC5370_00521) | - | 451825..452541 (+) | 717 | WP_111711584.1 | distal tail protein Dit | - |
| DQM44_RS02525 (NCTC5370_00522) | - | 452538..454685 (+) | 2148 | WP_111711585.1 | phage tail spike protein | - |
| DQM44_RS02530 (NCTC5370_00523) | - | 454682..455737 (+) | 1056 | WP_065354790.1 | hyaluronoglucosaminidase | - |
| DQM44_RS02535 (NCTC5370_00524) | - | 455737..456378 (+) | 642 | WP_111711586.1 | hypothetical protein | - |
| DQM44_RS02540 (NCTC5370_00525) | - | 456389..458299 (+) | 1911 | WP_065354792.1 | gp58-like family protein | - |
| DQM44_RS02545 (NCTC5370_00526) | - | 458312..458743 (+) | 432 | WP_003055326.1 | DUF1617 family protein | - |
| DQM44_RS02550 (NCTC5370_00527) | - | 458746..459354 (+) | 609 | WP_065354793.1 | DUF1366 domain-containing protein | - |
| DQM44_RS02555 (NCTC5370_00528) | - | 459365..459664 (+) | 300 | WP_023077839.1 | hypothetical protein | - |
| DQM44_RS02560 (NCTC5370_00529) | - | 459661..459846 (+) | 186 | WP_011184796.1 | holin | - |
| DQM44_RS02565 (NCTC5370_00531) | - | 459957..461153 (+) | 1197 | WP_111711587.1 | glucosaminidase domain-containing protein | - |
| DQM44_RS02570 (NCTC5370_00532) | - | 461343..461885 (+) | 543 | WP_032465096.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| DQM44_RS02575 (NCTC5370_00533) | - | 461889..462725 (+) | 837 | WP_111711588.1 | hypothetical protein | - |
| DQM44_RS02580 (NCTC5370_00534) | - | 462786..463775 (-) | 990 | WP_111711589.1 | DNA/RNA non-specific endonuclease | - |
| DQM44_RS02585 (NCTC5370_00535) | prx | 464008..464190 (+) | 183 | WP_111711590.1 | Paratox | Regulator |
| DQM44_RS02590 (NCTC5370_00536) | - | 464277..466685 (+) | 2409 | WP_044565581.1 | DNA translocase FtsK | - |
| DQM44_RS02595 (NCTC5370_00537) | - | 466755..467108 (-) | 354 | WP_002990803.1 | DUF3397 domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7013.02 Da Isoelectric Point: 4.0474
>NTDB_id=1136191 DQM44_RS02585 WP_111711590.1 464008..464190(+) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370]
MLTYDEFKQAIDNGYITADTVMIVRKDGQIFDYVLSGEKVRPWEIVAEEKVEEVLMELDK
MLTYDEFKQAIDNGYITADTVMIVRKDGQIFDYVLSGEKVRPWEIVAEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136191 DQM44_RS02585 WP_111711590.1 464008..464190(+) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGTCTGGTGAGAAAGTGAGACCGTGGGAGATTGTGGCCGAGGAGAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGTCTGGTGAGAAAGTGAGACCGTGGGAGATTGTGGCCGAGGAGAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS8232 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |