Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL11_RS03530 | Genome accession | NZ_LS483315 |
| Coordinates | 665270..665452 (+) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain NCTC12059 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 624859..665452 | 665270..665452 | within | 0 |
Gene organization within MGE regions
Location: 624859..665452
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL11_RS03240 (NCTC12059_00637) | recN | 624859..626520 (+) | 1662 | WP_002983909.1 | DNA repair protein RecN | - |
| DQL11_RS03245 (NCTC12059_00638) | - | 626692..627624 (+) | 933 | WP_111704583.1 | LPXTG cell wall anchor domain-containing protein | - |
| DQL11_RS03250 (NCTC12059_00639) | - | 627852..628691 (+) | 840 | WP_002989125.1 | DegV family protein | - |
| DQL11_RS03255 (NCTC12059_00640) | - | 628684..629526 (+) | 843 | WP_021340995.1 | SGNH/GDSL hydrolase family protein | - |
| DQL11_RS03260 (NCTC12059_00641) | - | 629504..630091 (+) | 588 | WP_111704584.1 | YpmS family protein | - |
| DQL11_RS03265 (NCTC12059_00642) | - | 630190..630465 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL11_RS03270 (NCTC12059_00643) | - | 630554..631696 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL11_RS03275 (NCTC12059_00644) | - | 631820..632338 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQL11_RS03280 (NCTC12059_00645) | - | 632350..633105 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQL11_RS03285 (NCTC12059_00646) | - | 633307..633519 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQL11_RS03290 (NCTC12059_00648) | - | 633789..634100 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQL11_RS03295 (NCTC12059_00649) | - | 634102..634287 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQL11_RS09290 | - | 634381..634650 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQL11_RS03305 (NCTC12059_00650) | - | 634791..635177 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQL11_RS03310 (NCTC12059_00651) | - | 635158..635391 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| DQL11_RS03315 (NCTC12059_00652) | - | 635388..635528 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| DQL11_RS03320 (NCTC12059_00653) | - | 635537..635743 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| DQL11_RS03325 (NCTC12059_00654) | - | 635799..636128 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| DQL11_RS03330 (NCTC12059_00655) | - | 636131..637057 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| DQL11_RS03335 (NCTC12059_00656) | - | 637054..637254 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DQL11_RS03340 (NCTC12059_00657) | - | 637247..638044 (+) | 798 | WP_111704585.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQL11_RS03345 (NCTC12059_00659) | - | 638409..638804 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DQL11_RS03350 (NCTC12059_00660) | - | 638801..640147 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| DQL11_RS03355 (NCTC12059_00661) | - | 640158..640490 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| DQL11_RS03360 (NCTC12059_00662) | - | 640487..640999 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| DQL11_RS03365 (NCTC12059_00663) | - | 641035..641352 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DQL11_RS09175 (NCTC12059_00664) | - | 641349..641504 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| DQL11_RS03370 (NCTC12059_00665) | - | 641501..641752 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| DQL11_RS03375 (NCTC12059_00666) | - | 641828..642247 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| DQL11_RS03380 | - | 642355..642699 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DQL11_RS03385 (NCTC12059_00667) | - | 642847..643203 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQL11_RS03390 (NCTC12059_00668) | - | 643200..644468 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| DQL11_RS03395 (NCTC12059_00669) | - | 644461..645954 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| DQL11_RS03400 (NCTC12059_00670) | - | 645960..646184 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQL11_RS03405 (NCTC12059_00671) | - | 646234..646413 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| DQL11_RS03410 (NCTC12059_00672) | - | 646406..646672 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| DQL11_RS03415 (NCTC12059_00673) | - | 646674..646910 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| DQL11_RS03420 (NCTC12059_00674) | - | 646992..648407 (+) | 1416 | WP_111704586.1 | terminase | - |
| DQL11_RS03425 (NCTC12059_00675) | - | 648488..648952 (+) | 465 | WP_053308482.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQL11_RS03430 (NCTC12059_00676) | - | 648956..649849 (+) | 894 | WP_053308481.1 | phage major capsid protein | - |
| DQL11_RS09410 (NCTC12059_00677) | - | 649851..649979 (+) | 129 | WP_258296905.1 | hypothetical protein | - |
| DQL11_RS03435 (NCTC12059_00678) | - | 650000..650422 (+) | 423 | WP_109828577.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL11_RS03440 (NCTC12059_00679) | - | 650382..650720 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQL11_RS03445 (NCTC12059_00680) | - | 650713..650952 (+) | 240 | WP_111704587.1 | hypothetical protein | - |
| DQL11_RS03450 (NCTC12059_00681) | - | 650953..651288 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQL11_RS03455 (NCTC12059_00682) | - | 651304..651894 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| DQL11_RS03460 (NCTC12059_00683) | - | 651905..652168 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| DQL11_RS03465 (NCTC12059_00684) | - | 652183..652554 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| DQL11_RS03470 (NCTC12059_00685) | - | 652554..654917 (+) | 2364 | WP_111704588.1 | hypothetical protein | - |
| DQL11_RS03475 (NCTC12059_00686) | - | 654914..655609 (+) | 696 | WP_111704589.1 | hypothetical protein | - |
| DQL11_RS03480 (NCTC12059_00687) | - | 655591..657564 (+) | 1974 | WP_168388764.1 | phage tail spike protein | - |
| DQL11_RS03485 (NCTC12059_00688) | hylP | 657564..658673 (+) | 1110 | WP_111703211.1 | hyaluronoglucosaminidase | - |
| DQL11_RS03490 (NCTC12059_00689) | - | 658688..660469 (+) | 1782 | WP_111704590.1 | gp58-like family protein | - |
| DQL11_RS03495 (NCTC12059_00690) | - | 660478..660906 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| DQL11_RS03500 (NCTC12059_00691) | - | 660909..661541 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| DQL11_RS03505 (NCTC12059_00692) | - | 661553..661825 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQL11_RS03510 (NCTC12059_00693) | - | 661822..662049 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQL11_RS03515 (NCTC12059_00695) | - | 662168..663385 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| DQL11_RS03520 (NCTC12059_00696) | speC | 663454..664161 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL11_RS03525 (NCTC12059_00697) | mf2 | 664272..665030 (-) | 759 | WP_111704591.1 | DNase Mf2 | - |
| DQL11_RS03530 (NCTC12059_00698) | prx | 665270..665452 (+) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=1136064 DQL11_RS03530 WP_014635572.1 665270..665452(+) (prx) [Streptococcus pyogenes strain NCTC12059]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136064 DQL11_RS03530 WP_014635572.1 665270..665452(+) (prx) [Streptococcus pyogenes strain NCTC12059]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |