Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM39_RS02795 | Genome accession | NZ_LS483298 |
| Coordinates | 503456..503635 (+) | Length | 59 a.a. |
| NCBI ID | WP_002983481.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8225 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 464034..503635 | 503456..503635 | within | 0 |
Gene organization within MGE regions
Location: 464034..503635
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM39_RS02575 (NCTC8225_00515) | - | 464880..465737 (-) | 858 | WP_111680774.1 | DNA adenine methylase | - |
| DQM39_RS02580 (NCTC8225_00516) | - | 465794..467497 (-) | 1704 | WP_111680775.1 | ATP-dependent nuclease | - |
| DQM39_RS02585 (NCTC8225_00517) | - | 467622..468008 (-) | 387 | WP_002983397.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM39_RS02590 (NCTC8225_00518) | - | 468012..468359 (-) | 348 | WP_002983399.1 | helix-turn-helix domain-containing protein | - |
| DQM39_RS02595 (NCTC8225_00519) | - | 468652..468861 (+) | 210 | WP_002983400.1 | helix-turn-helix domain-containing protein | - |
| DQM39_RS02600 (NCTC8225_00520) | - | 468920..469195 (+) | 276 | WP_032467257.1 | DNA-binding phage protein | - |
| DQM39_RS02605 (NCTC8225_00521) | - | 469192..469362 (+) | 171 | WP_002983403.1 | hypothetical protein | - |
| DQM39_RS02610 (NCTC8225_00522) | - | 469355..469561 (+) | 207 | WP_002983404.1 | hypothetical protein | - |
| DQM39_RS02615 (NCTC8225_00523) | - | 469558..469941 (+) | 384 | WP_002983405.1 | hypothetical protein | - |
| DQM39_RS09935 (NCTC8225_00524) | - | 469938..470090 (+) | 153 | WP_002983406.1 | hypothetical protein | - |
| DQM39_RS02620 (NCTC8225_00525) | - | 470087..470290 (+) | 204 | WP_002983407.1 | hypothetical protein | - |
| DQM39_RS02625 (NCTC8225_00526) | - | 470378..470677 (+) | 300 | WP_002983408.1 | hypothetical protein | - |
| DQM39_RS02630 (NCTC8225_00527) | - | 470677..471834 (+) | 1158 | WP_002983409.1 | DUF2800 domain-containing protein | - |
| DQM39_RS02635 (NCTC8225_00528) | - | 471848..472411 (+) | 564 | WP_111680776.1 | DUF2815 family protein | - |
| DQM39_RS02640 (NCTC8225_00529) | - | 472454..474385 (+) | 1932 | WP_002983411.1 | DNA polymerase | - |
| DQM39_RS02645 (NCTC8225_00530) | - | 474390..476774 (+) | 2385 | WP_002983412.1 | phage/plasmid primase, P4 family | - |
| DQM39_RS02650 (NCTC8225_00531) | - | 477141..477416 (+) | 276 | WP_002983413.1 | VRR-NUC domain-containing protein | - |
| DQM39_RS02655 (NCTC8225_00532) | - | 477413..478735 (+) | 1323 | WP_111680777.1 | SNF2-related protein | - |
| DQM39_RS09940 (NCTC8225_00533) | - | 478736..478897 (+) | 162 | WP_002983415.1 | hypothetical protein | - |
| DQM39_RS02660 (NCTC8225_00534) | - | 478900..479166 (+) | 267 | WP_032467258.1 | hypothetical protein | - |
| DQM39_RS02665 (NCTC8225_00536) | - | 479299..479712 (+) | 414 | WP_002983418.1 | transcriptional regulator | - |
| DQM39_RS02670 (NCTC8225_00537) | - | 479808..480260 (+) | 453 | WP_032467259.1 | terminase small subunit | - |
| DQM39_RS02675 (NCTC8225_00538) | - | 480250..481527 (+) | 1278 | WP_002983420.1 | PBSX family phage terminase large subunit | - |
| DQM39_RS02680 (NCTC8225_00539) | - | 481542..483074 (+) | 1533 | WP_002983421.1 | phage portal protein | - |
| DQM39_RS02685 (NCTC8225_00540) | - | 483034..484479 (+) | 1446 | WP_002983422.1 | minor capsid protein | - |
| DQM39_RS02690 | - | 484510..484698 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| DQM39_RS02695 (NCTC8225_00542) | - | 484701..484967 (+) | 267 | WP_002983424.1 | hypothetical protein | - |
| DQM39_RS02700 (NCTC8225_00543) | - | 485128..485697 (+) | 570 | WP_002983425.1 | DUF4355 domain-containing protein | - |
| DQM39_RS02705 (NCTC8225_00544) | - | 485710..486597 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| DQM39_RS02710 (NCTC8225_00545) | - | 486609..486965 (+) | 357 | WP_002983431.1 | phage head-tail connector protein | - |
| DQM39_RS02715 (NCTC8225_00546) | - | 486976..487254 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| DQM39_RS02720 (NCTC8225_00547) | - | 487251..487595 (+) | 345 | WP_050317072.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM39_RS02725 (NCTC8225_00548) | - | 487599..487958 (+) | 360 | WP_002983439.1 | hypothetical protein | - |
| DQM39_RS02730 (NCTC8225_00549) | - | 487970..488569 (+) | 600 | WP_002983441.1 | phage major tail protein, TP901-1 family | - |
| DQM39_RS02735 (NCTC8225_00550) | - | 488623..489078 (+) | 456 | WP_111680778.1 | tail assembly chaperone | - |
| DQM39_RS02740 (NCTC8225_00551) | - | 489153..489386 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| DQM39_RS02745 (NCTC8225_00552) | - | 489401..493426 (+) | 4026 | WP_002983447.1 | tape measure protein | - |
| DQM39_RS02750 (NCTC8225_00553) | - | 493438..494280 (+) | 843 | WP_002983449.1 | phage tail family protein | - |
| DQM39_RS02755 (NCTC8225_00554) | - | 494290..496329 (+) | 2040 | WP_111680779.1 | phage tail protein | - |
| DQM39_RS02760 (NCTC8225_00555) | - | 496329..497450 (+) | 1122 | WP_111680780.1 | hyaluronoglucosaminidase | - |
| DQM39_RS02765 (NCTC8225_00556) | - | 497463..499481 (+) | 2019 | WP_111680781.1 | gp58-like family protein | - |
| DQM39_RS02770 (NCTC8225_00557) | - | 499493..499924 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| DQM39_RS02775 (NCTC8225_00558) | - | 499927..500559 (+) | 633 | WP_002983470.1 | hypothetical protein | - |
| DQM39_RS02780 (NCTC8225_00559) | - | 500570..501025 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| DQM39_RS02785 (NCTC8225_00561) | - | 501137..502350 (+) | 1214 | Protein_496 | peptidoglycan amidohydrolase family protein | - |
| DQM39_RS02790 (NCTC8225_00563) | - | 502595..503389 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| DQM39_RS02795 (NCTC8225_00564) | prx | 503456..503635 (+) | 180 | WP_002983481.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.1813
>NTDB_id=1135463 DQM39_RS02795 WP_002983481.1 503456..503635(+) (prx) [Streptococcus pyogenes strain NCTC8225]
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1135463 DQM39_RS02795 WP_002983481.1 503456..503635(+) (prx) [Streptococcus pyogenes strain NCTC8225]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
100 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
71.186 |
0.542 |