Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM39_RS01460 | Genome accession | NZ_LS483298 |
| Coordinates | 235891..236073 (+) | Length | 60 a.a. |
| NCBI ID | WP_002986147.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8225 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 196873..237691 | 235891..236073 | within | 0 |
Gene organization within MGE regions
Location: 196873..237691
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM39_RS01185 (NCTC8225_00233) | - | 196873..198105 (-) | 1233 | WP_002986305.1 | transglutaminase domain-containing protein | - |
| DQM39_RS10030 (NCTC8225_00235) | - | 198481..199623 (-) | 1143 | WP_197709845.1 | tyrosine-type recombinase/integrase | - |
| DQM39_RS01200 (NCTC8225_00236) | - | 199750..200283 (-) | 534 | WP_002986291.1 | hypothetical protein | - |
| DQM39_RS01205 (NCTC8225_00237) | - | 200295..200675 (-) | 381 | WP_002986288.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM39_RS01210 (NCTC8225_00238) | - | 200685..201035 (-) | 351 | WP_032467305.1 | helix-turn-helix domain-containing protein | - |
| DQM39_RS01215 (NCTC8225_00239) | - | 201346..201561 (+) | 216 | WP_002986282.1 | hypothetical protein | - |
| DQM39_RS10220 (NCTC8225_00240) | - | 201635..201769 (+) | 135 | WP_002986279.1 | hypothetical protein | - |
| DQM39_RS01220 (NCTC8225_00241) | - | 201766..202509 (+) | 744 | WP_002986270.1 | ORF6C domain-containing protein | - |
| DQM39_RS01225 (NCTC8225_00242) | - | 202585..202797 (+) | 213 | WP_002986266.1 | hypothetical protein | - |
| DQM39_RS01230 (NCTC8225_00243) | - | 202831..203022 (+) | 192 | WP_002986264.1 | hypothetical protein | - |
| DQM39_RS09900 (NCTC8225_00244) | - | 203054..203209 (+) | 156 | WP_002986261.1 | hypothetical protein | - |
| DQM39_RS01235 (NCTC8225_00245) | - | 203211..203753 (-) | 543 | WP_002986259.1 | hypothetical protein | - |
| DQM39_RS01240 (NCTC8225_00246) | - | 203884..204144 (+) | 261 | WP_002986256.1 | hypothetical protein | - |
| DQM39_RS01245 (NCTC8225_00247) | - | 204163..204351 (+) | 189 | WP_002986254.1 | hypothetical protein | - |
| DQM39_RS01250 (NCTC8225_00248) | dnaB | 204338..205684 (+) | 1347 | WP_111680752.1 | replicative DNA helicase | - |
| DQM39_RS01255 (NCTC8225_00249) | - | 205671..206273 (+) | 603 | WP_002986249.1 | hypothetical protein | - |
| DQM39_RS01260 (NCTC8225_00250) | - | 206251..206997 (+) | 747 | WP_002986245.1 | conserved phage C-terminal domain-containing protein | - |
| DQM39_RS01265 (NCTC8225_00251) | - | 206998..207822 (+) | 825 | WP_002986242.1 | ATP-binding protein | - |
| DQM39_RS01270 (NCTC8225_00252) | - | 207822..208049 (+) | 228 | WP_002986238.1 | hypothetical protein | - |
| DQM39_RS01275 (NCTC8225_00253) | - | 208039..208239 (+) | 201 | WP_002986235.1 | hypothetical protein | - |
| DQM39_RS01280 (NCTC8225_00254) | - | 208236..208520 (+) | 285 | WP_002986233.1 | hypothetical protein | - |
| DQM39_RS01285 (NCTC8225_00255) | - | 208523..209161 (+) | 639 | WP_050452837.1 | DNA cytosine methyltransferase | - |
| DQM39_RS09905 (NCTC8225_00256) | - | 209149..209304 (+) | 156 | WP_002986227.1 | hypothetical protein | - |
| DQM39_RS10035 | - | 209285..209503 (+) | 219 | WP_002986224.1 | hypothetical protein | - |
| DQM39_RS10040 (NCTC8225_00257) | - | 209510..209749 (+) | 240 | WP_002986221.1 | DNA cytosine methyltransferase | - |
| DQM39_RS10045 (NCTC8225_00258) | - | 209739..210011 (+) | 273 | Protein_206 | hypothetical protein | - |
| DQM39_RS10050 | - | 210165..210338 (+) | 174 | Protein_207 | DUF3310 domain-containing protein | - |
| DQM39_RS01305 (NCTC8225_00259) | - | 210331..210663 (+) | 333 | WP_002986215.1 | hypothetical protein | - |
| DQM39_RS01310 (NCTC8225_00260) | - | 210656..210985 (+) | 330 | WP_002986212.1 | helix-turn-helix domain-containing protein | - |
| DQM39_RS09915 (NCTC8225_00261) | - | 210982..211155 (+) | 174 | WP_002986209.1 | hypothetical protein | - |
| DQM39_RS01315 (NCTC8225_00262) | - | 211158..211406 (+) | 249 | WP_002986206.1 | hypothetical protein | - |
| DQM39_RS09920 (NCTC8225_00264) | - | 211591..211740 (+) | 150 | WP_002986201.1 | hypothetical protein | - |
| DQM39_RS01325 (NCTC8225_00265) | - | 211709..211909 (+) | 201 | WP_002986198.1 | hypothetical protein | - |
| DQM39_RS01330 (NCTC8225_00266) | - | 211933..212352 (+) | 420 | WP_002986196.1 | DUF1492 domain-containing protein | - |
| DQM39_RS01335 (NCTC8225_00267) | - | 212447..213010 (+) | 564 | WP_032467304.1 | site-specific integrase | - |
| DQM39_RS01340 (NCTC8225_00268) | - | 213182..213475 (+) | 294 | WP_002986191.1 | hypothetical protein | - |
| DQM39_RS01345 (NCTC8225_00269) | - | 213472..213801 (+) | 330 | WP_002986189.1 | HNH endonuclease | - |
| DQM39_RS01350 (NCTC8225_00270) | - | 213923..214270 (+) | 348 | WP_002986187.1 | hypothetical protein | - |
| DQM39_RS01355 (NCTC8225_00271) | - | 214251..215909 (+) | 1659 | WP_002986185.1 | terminase TerL endonuclease subunit | - |
| DQM39_RS01360 (NCTC8225_00272) | - | 216108..217343 (+) | 1236 | WP_002986182.1 | phage portal protein | - |
| DQM39_RS01365 (NCTC8225_00273) | - | 217347..218063 (+) | 717 | WP_002986180.1 | head maturation protease, ClpP-related | - |
| DQM39_RS01370 (NCTC8225_00274) | - | 218099..219292 (+) | 1194 | WP_002986177.1 | phage major capsid protein | - |
| DQM39_RS01375 (NCTC8225_00275) | - | 219307..219594 (+) | 288 | WP_002986176.1 | hypothetical protein | - |
| DQM39_RS01380 (NCTC8225_00276) | - | 219614..219907 (+) | 294 | WP_002986174.1 | phage gp6-like head-tail connector protein | - |
| DQM39_RS01385 (NCTC8225_00277) | - | 219909..220286 (+) | 378 | WP_111680753.1 | phage head-tail adapter protein | - |
| DQM39_RS01390 (NCTC8225_00278) | - | 220258..220629 (+) | 372 | WP_002986170.1 | hypothetical protein | - |
| DQM39_RS01395 (NCTC8225_00279) | - | 220638..221060 (+) | 423 | WP_002986168.1 | hypothetical protein | - |
| DQM39_RS01400 (NCTC8225_00280) | - | 221071..221658 (+) | 588 | WP_002986166.1 | hypothetical protein | - |
| DQM39_RS01405 (NCTC8225_00281) | - | 221679..222050 (+) | 372 | WP_002986164.1 | hypothetical protein | - |
| DQM39_RS09925 (NCTC8225_00282) | - | 222086..222244 (+) | 159 | WP_002986162.1 | hypothetical protein | - |
| DQM39_RS01410 (NCTC8225_00283) | - | 222318..225719 (+) | 3402 | WP_002986160.1 | phage tail tape measure protein | - |
| DQM39_RS01415 (NCTC8225_00284) | - | 225716..226426 (+) | 711 | WP_002986157.1 | phage tail domain-containing protein | - |
| DQM39_RS01420 (NCTC8225_00285) | - | 226423..228471 (+) | 2049 | WP_002986155.1 | phage tail spike protein | - |
| DQM39_RS01425 (NCTC8225_00286) | hylP | 228471..229493 (+) | 1023 | WP_111680755.1 | hyaluronidase HylP | - |
| DQM39_RS01430 (NCTC8225_00287) | - | 229504..231519 (+) | 2016 | WP_111680756.1 | gp58-like family protein | - |
| DQM39_RS01435 (NCTC8225_00288) | - | 231531..231962 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQM39_RS01440 (NCTC8225_00289) | - | 231965..232582 (+) | 618 | WP_111680757.1 | DUF1366 domain-containing protein | - |
| DQM39_RS01445 (NCTC8225_00290) | - | 232592..233047 (+) | 456 | WP_111680758.1 | phage holin family protein | - |
| DQM39_RS01450 (NCTC8225_00292) | - | 233159..234364 (+) | 1206 | WP_002986150.1 | glucosaminidase domain-containing protein | - |
| DQM39_RS01455 (NCTC8225_00293) | sda1 | 234480..235652 (-) | 1173 | WP_032467302.1 | streptodornase Sda1 | - |
| DQM39_RS01460 (NCTC8225_00294) | prx | 235891..236073 (+) | 183 | WP_002986147.1 | hypothetical protein | Regulator |
| DQM39_RS01465 (NCTC8225_00295) | - | 236123..236314 (-) | 192 | WP_002986145.1 | helix-turn-helix domain-containing protein | - |
| DQM39_RS01470 (NCTC8225_00297) | speG | 236987..237691 (+) | 705 | WP_002986141.1 | streptococcal pyrogenic exotoxin SpeG | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6892.81 Da Isoelectric Point: 4.0474
>NTDB_id=1135451 DQM39_RS01460 WP_002986147.1 235891..236073(+) (prx) [Streptococcus pyogenes strain NCTC8225]
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVSPGEKVRPWEVVAEEKVEEVVMELDK
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVSPGEKVRPWEVVAEEKVEEVVMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1135451 DQM39_RS01460 WP_002986147.1 235891..236073(+) (prx) [Streptococcus pyogenes strain NCTC8225]
ATGCTAACATACGATGAGTTTAAACAAGCGATTGATGACGGCTATATCGTAGGCGACACAGTCGCAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTCGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGGCTGAGGAAAAAGTGGAAGAAG
TGGTGATGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAACAAGCGATTGATGACGGCTATATCGTAGGCGACACAGTCGCAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTCGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGGCTGAGGAAAAAGTGGAAGAAG
TGGTGATGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS8232 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |