Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | H1W80_RS09330 | Genome accession | NZ_LR822040 |
| Coordinates | 265960..266169 (+) | Length | 69 a.a. |
| NCBI ID | WP_232086550.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1125 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 260960..271169
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W80_RS01425 (STHERMO_0288) | - | 261366..261905 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| H1W80_RS01430 (STHERMO_0289) | - | 262216..262773 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| H1W80_RS01435 (STHERMO_0290) | - | 262776..263426 (+) | 651 | WP_022096567.1 | phosphatase PAP2 family protein | - |
| H1W80_RS01440 (STHERMO_0292) | comR | 263621..264520 (+) | 900 | WP_002946143.1 | helix-turn-helix domain-containing protein | Regulator |
| H1W80_RS09320 | - | 264758..265081 (+) | 324 | Protein_234 | cysteine peptidase family C39 domain-containing protein | - |
| H1W80_RS09785 (STHERMO_0295) | comA | 265227..265670 (+) | 444 | WP_260232029.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| H1W80_RS09790 (STHERMO_0296) | comA | 265648..265938 (+) | 291 | WP_180473397.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| H1W80_RS09330 (STHERMO_0297) | comA | 265960..266169 (+) | 210 | WP_232086550.1 | peptidase | Regulator |
| H1W80_RS01465 (STHERMO_0299) | - | 266224..266792 (+) | 569 | Protein_238 | ATP-binding cassette domain-containing protein | - |
| H1W80_RS01470 (STHERMO_0300) | - | 266900..267211 (+) | 312 | WP_022096570.1 | DUF805 domain-containing protein | - |
| H1W80_RS01475 (STHERMO_0303) | - | 267638..268534 (-) | 897 | WP_232086552.1 | urease cluster protein | - |
| H1W80_RS01480 (STHERMO_0304) | - | 268939..269454 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| H1W80_RS01485 (STHERMO_0305) | - | 269479..269781 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| H1W80_RS01490 (STHERMO_0306) | - | 269793..270104 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8173.54 Da Isoelectric Point: 9.7339
>NTDB_id=1132030 H1W80_RS09330 WP_232086550.1 265960..266169(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1125]
MITYSMLLNYFTTPLINIIYLQSKIQQSKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQSKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1132030 H1W80_RS09330 WP_232086550.1 265960..266169(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1125]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
ATCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
ATCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
52.778 |
100 |
0.551 |
| comA | Streptococcus mitis NCTC 12261 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae Rx1 |
50 |
100 |
0.522 |
| comA | Streptococcus pneumoniae D39 |
50 |
100 |
0.522 |
| comA | Streptococcus pneumoniae R6 |
50 |
100 |
0.522 |
| comA | Streptococcus pneumoniae TIGR4 |
50 |
100 |
0.522 |
| comA | Streptococcus mitis SK321 |
48.611 |
100 |
0.507 |
| comA/nlmT | Streptococcus mutans UA159 |
42.857 |
100 |
0.435 |