Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H1X38_RS03875 | Genome accession | NZ_LR822035 |
| Coordinates | 736366..736527 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1051 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 715598..744281 | 736366..736527 | within | 0 |
Gene organization within MGE regions
Location: 715598..744281
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1X38_RS03790 (STHERMO_0798) | - | 715598..716188 (+) | 591 | WP_011227082.1 | thymidine kinase | - |
| H1X38_RS03795 (STHERMO_0799) | prfA | 716231..717310 (+) | 1080 | WP_002948472.1 | peptide chain release factor 1 | - |
| H1X38_RS03800 (STHERMO_0800) | prmC | 717307..718140 (+) | 834 | WP_011681016.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| H1X38_RS03805 (STHERMO_0801) | - | 718127..718732 (+) | 606 | WP_002948474.1 | L-threonylcarbamoyladenylate synthase | - |
| H1X38_RS03810 (STHERMO_0802) | glyA | 718827..720077 (+) | 1251 | WP_014727417.1 | serine hydroxymethyltransferase | - |
| H1X38_RS03815 (STHERMO_0803) | - | 720084..721061 (+) | 978 | WP_014608183.1 | nucleoid-associated protein | - |
| H1X38_RS03820 (STHERMO_0804) | - | 721063..721674 (+) | 612 | WP_041827329.1 | lysozyme family protein | - |
| H1X38_RS03825 (STHERMO_0805) | - | 721707..723446 (+) | 1740 | WP_011681019.1 | ABC transporter ATP-binding protein | - |
| H1X38_RS03830 (STHERMO_0806) | - | 723436..725184 (+) | 1749 | WP_011681020.1 | ABC transporter ATP-binding protein | - |
| H1X38_RS03835 | - | 725362..725493 (+) | 132 | WP_002885174.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| H1X38_RS03840 (STHERMO_0808) | dltA | 725502..727052 (+) | 1551 | WP_011681022.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| H1X38_RS03845 (STHERMO_0809) | dltB | 727049..728296 (+) | 1248 | WP_014608186.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| H1X38_RS03850 (STHERMO_0810) | dltC | 728314..728553 (+) | 240 | WP_002950439.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| H1X38_RS03855 (STHERMO_0811) | dltD | 728546..729814 (+) | 1269 | WP_011681024.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| H1X38_RS03860 | - | 729867..731216 (-) | 1350 | Protein_708 | IS3 family transposase | - |
| H1X38_RS03865 (STHERMO_0817) | - | 731415..734051 (-) | 2637 | WP_014727421.1 | calcium-translocating P-type ATPase, PMCA-type | - |
| H1X38_RS03870 (STHERMO_0818) | pabB | 734228..735946 (-) | 1719 | WP_014608193.1 | aminodeoxychorismate synthase component I | - |
| H1X38_RS03875 (STHERMO_0819) | prx | 736366..736527 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| H1X38_RS03880 (STHERMO_0821) | - | 737011..737286 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| H1X38_RS03885 (STHERMO_0822) | - | 737303..737485 (-) | 183 | WP_014727424.1 | hypothetical protein | - |
| H1X38_RS03890 (STHERMO_0823) | - | 737814..738887 (-) | 1074 | WP_014727425.1 | VapE domain-containing protein | - |
| H1X38_RS03895 (STHERMO_0824) | - | 739223..740080 (-) | 858 | WP_014727426.1 | primase alpha helix C-terminal domain-containing protein | - |
| H1X38_RS03900 (STHERMO_0825) | - | 740095..740367 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| H1X38_RS03905 (STHERMO_0826) | - | 740369..740710 (-) | 342 | WP_224102964.1 | hypothetical protein | - |
| H1X38_RS03910 (STHERMO_0827) | - | 740697..740933 (-) | 237 | WP_014727428.1 | hypothetical protein | - |
| H1X38_RS03915 (STHERMO_0828) | - | 740947..741141 (-) | 195 | WP_014727429.1 | hypothetical protein | - |
| H1X38_RS03920 (STHERMO_0829) | - | 741145..741450 (-) | 306 | WP_014727430.1 | hypothetical protein | - |
| H1X38_RS03925 (STHERMO_0830) | - | 741670..741867 (-) | 198 | WP_014727431.1 | helix-turn-helix domain-containing protein | - |
| H1X38_RS03930 (STHERMO_0831) | - | 742030..742548 (+) | 519 | WP_002948197.1 | helix-turn-helix transcriptional regulator | - |
| H1X38_RS03935 (STHERMO_0832) | - | 742664..743830 (+) | 1167 | WP_014727432.1 | tyrosine-type recombinase/integrase | - |
| H1X38_RS03940 (STHERMO_0833) | - | 743946..744281 (+) | 336 | WP_011225805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=1131764 H1X38_RS03875 WP_014727422.1 736366..736527(-) (prx) [Streptococcus thermophilus isolate STH_CIRM_1051]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=1131764 H1X38_RS03875 WP_014727422.1 736366..736527(-) (prx) [Streptococcus thermophilus isolate STH_CIRM_1051]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |