Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | H0510_RS09355 | Genome accession | NZ_LR822019 |
| Coordinates | 269360..269569 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_772 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 264360..274569
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H0510_RS01455 (STHERMO_0292) | - | 264766..265305 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| H0510_RS01460 (STHERMO_0293) | - | 265617..266174 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| H0510_RS01465 (STHERMO_0294) | - | 266177..266827 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| H0510_RS01470 (STHERMO_0295) | comR | 267022..267921 (+) | 900 | WP_002946143.1 | helix-turn-helix domain-containing protein | Regulator |
| H0510_RS09790 | - | 268096..268503 (+) | 408 | Protein_239 | cysteine peptidase family C39 domain-containing protein | - |
| H0510_RS09795 | comA | 268606..269070 (+) | 465 | WP_260215160.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| H0510_RS09800 (STHERMO_0298) | comA | 269048..269338 (+) | 291 | WP_179966908.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| H0510_RS09355 (STHERMO_0299) | comA | 269360..269569 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| H0510_RS01490 (STHERMO_0301) | - | 269624..270192 (+) | 569 | Protein_243 | ATP-binding cassette domain-containing protein | - |
| H0510_RS01495 (STHERMO_0302) | - | 270300..270611 (+) | 312 | WP_011226857.1 | DUF805 domain-containing protein | - |
| H0510_RS09365 | - | 270832..271179 (-) | 348 | WP_232086705.1 | DUF4153 domain-containing protein | - |
| H0510_RS09370 (STHERMO_0305) | - | 271104..272000 (-) | 897 | WP_232086673.1 | urease cluster protein | - |
| H0510_RS01505 (STHERMO_0306) | - | 272405..272920 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| H0510_RS01510 (STHERMO_0307) | - | 272945..273247 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| H0510_RS01515 (STHERMO_0308) | - | 273259..273570 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=1131056 H0510_RS09355 WP_002946147.1 269360..269569(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_772]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1131056 H0510_RS09355 WP_002946147.1 269360..269569(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_772]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |