Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   FGL21_RS10300 Genome accession   NZ_LR594047
Coordinates   2068314..2068496 (-) Length   60 a.a.
NCBI ID   WP_138128179.1    Uniprot ID   -
Organism   Streptococcus dysgalactiae subsp. equisimilis strain NCTC11554     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2059101..2111972 2068314..2068496 within 0
IS/Tn 2066717..2068081 2068314..2068496 flank 233


Gene organization within MGE regions


Location: 2059101..2111972
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL21_RS10260 (NCTC11554_02131) - 2059101..2059568 (+) 468 WP_003054740.1 8-oxo-dGTP diphosphatase -
  FGL21_RS10265 (NCTC11554_02132) groL 2059784..2061409 (-) 1626 WP_003054752.1 chaperonin GroEL -
  FGL21_RS10270 (NCTC11554_02133) groES 2061445..2061735 (-) 291 WP_003054738.1 co-chaperone GroES -
  FGL21_RS10275 (NCTC11554_02134) clpC 2061913..2064357 (-) 2445 WP_003054754.1 ATP-dependent Clp protease ATP-binding subunit Regulator
  FGL21_RS10280 (NCTC11554_02135) - 2064357..2064818 (-) 462 WP_003054759.1 CtsR family transcriptional regulator -
  FGL21_RS10285 - 2065014..2065217 (-) 204 WP_003053018.1 cold-shock protein -
  FGL21_RS11460 (NCTC11554_02137) - 2065719..2066324 (+) 606 WP_223846053.1 amidohydrolase family protein -
  FGL21_RS10295 (NCTC11554_02138) - 2066717..2068081 (-) 1365 WP_014612625.1 IS1182 family transposase -
  FGL21_RS10300 (NCTC11554_02139) prx 2068314..2068496 (-) 183 WP_138128179.1 Paratox Regulator
  FGL21_RS10305 (NCTC11554_02140) - 2068735..2069892 (+) 1158 WP_138128182.1 DNA/RNA non-specific endonuclease -
  FGL21_RS10310 (NCTC11554_02141) - 2070059..2071039 (-) 981 WP_138128184.1 Abi family protein -
  FGL21_RS10315 (NCTC11554_02142) - 2071333..2072547 (-) 1215 WP_138128186.1 peptidoglycan amidohydrolase family protein -
  FGL21_RS10320 (NCTC11554_02144) - 2072658..2072843 (-) 186 WP_011184796.1 holin -
  FGL21_RS10325 (NCTC11554_02145) - 2072840..2073139 (-) 300 WP_023077839.1 hypothetical protein -
  FGL21_RS10330 (NCTC11554_02146) - 2073150..2073758 (-) 609 WP_138128188.1 hypothetical protein -
  FGL21_RS10335 (NCTC11554_02147) - 2073761..2074192 (-) 432 WP_138128190.1 DUF1617 family protein -
  FGL21_RS10340 (NCTC11554_02148) - 2074205..2076223 (-) 2019 WP_138128192.1 gp58-like family protein -
  FGL21_RS10345 (NCTC11554_02149) - 2076234..2076869 (-) 636 WP_138128194.1 hypothetical protein -
  FGL21_RS10350 (NCTC11554_02150) - 2076869..2077924 (-) 1056 WP_138128196.1 hyaluronoglucosaminidase -
  FGL21_RS10355 (NCTC11554_02151) - 2077921..2080065 (-) 2145 WP_138128198.1 phage tail spike protein -
  FGL21_RS10360 (NCTC11554_02152) - 2080062..2080778 (-) 717 WP_138128200.1 distal tail protein Dit -
  FGL21_RS10365 (NCTC11554_02153) - 2080775..2084035 (-) 3261 WP_138128276.1 tape measure protein -
  FGL21_RS10370 (NCTC11554_02154) - 2084025..2084606 (-) 582 WP_138128203.1 bacteriophage Gp15 family protein -
  FGL21_RS10375 (NCTC11554_02155) - 2084610..2085044 (-) 435 WP_010922086.1 hypothetical protein -
  FGL21_RS10380 (NCTC11554_02156) - 2085088..2085552 (-) 465 WP_138128205.1 phage tail protein -
  FGL21_RS10385 (NCTC11554_02157) - 2085552..2085950 (-) 399 WP_138128207.1 minor capsid protein -
  FGL21_RS10390 (NCTC11554_02158) - 2085947..2086303 (-) 357 WP_065361215.1 minor capsid protein -
  FGL21_RS10395 (NCTC11554_02159) - 2086303..2086635 (-) 333 WP_111679814.1 minor capsid protein -
  FGL21_RS10400 (NCTC11554_02160) - 2086625..2087041 (-) 417 WP_111679813.1 hypothetical protein -
  FGL21_RS10405 (NCTC11554_02161) - 2087095..2087913 (-) 819 WP_111679812.1 N4-gp56 family major capsid protein -
  FGL21_RS10410 (NCTC11554_02162) - 2087917..2088531 (-) 615 WP_111711580.1 hypothetical protein -
  FGL21_RS10415 (NCTC11554_02163) - 2088669..2088935 (-) 267 WP_115283414.1 hypothetical protein -
  FGL21_RS10420 (NCTC11554_02164) - 2089009..2089236 (-) 228 WP_111679809.1 hypothetical protein -
  FGL21_RS10425 (NCTC11554_02165) - 2089233..2090729 (-) 1497 WP_111711579.1 phage minor capsid protein -
  FGL21_RS10430 (NCTC11554_02166) - 2090734..2092236 (-) 1503 WP_111711578.1 phage portal protein -
  FGL21_RS10435 (NCTC11554_02167) - 2092250..2093536 (-) 1287 WP_280641434.1 PBSX family phage terminase large subunit -
  FGL21_RS10440 (NCTC11554_02168) - 2093539..2094015 (-) 477 WP_030127706.1 terminase small subunit -
  FGL21_RS10450 (NCTC11554_02170) - 2094725..2095162 (-) 438 WP_003052405.1 DUF1492 domain-containing protein -
  FGL21_RS11295 (NCTC11554_02171) - 2095524..2095694 (-) 171 WP_002987493.1 hypothetical protein -
  FGL21_RS10455 (NCTC11554_02172) - 2095691..2096242 (-) 552 WP_138128209.1 DUF1642 domain-containing protein -
  FGL21_RS10460 (NCTC11554_02173) - 2096344..2096583 (-) 240 WP_138083800.1 hypothetical protein -
  FGL21_RS10465 (NCTC11554_02174) - 2096585..2096812 (-) 228 WP_138083799.1 hypothetical protein -
  FGL21_RS10470 (NCTC11554_02175) - 2096809..2097729 (-) 921 WP_138128211.1 N-6 DNA methylase -
  FGL21_RS10475 (NCTC11554_02176) - 2097732..2098001 (-) 270 WP_172601656.1 hypothetical protein -
  FGL21_RS10480 (NCTC11554_02177) - 2098001..2098177 (-) 177 WP_032460883.1 hypothetical protein -
  FGL21_RS10485 (NCTC11554_02178) - 2098174..2098563 (-) 390 WP_138128215.1 YopX family protein -
  FGL21_RS10490 (NCTC11554_02179) - 2098560..2098754 (-) 195 WP_138128217.1 hypothetical protein -
  FGL21_RS10495 (NCTC11554_02180) - 2098741..2099253 (-) 513 WP_138128219.1 crossover junction endodeoxyribonuclease RuvC -
  FGL21_RS10500 (NCTC11554_02181) - 2099250..2099585 (-) 336 WP_138128221.1 hypothetical protein -
  FGL21_RS11300 (NCTC11554_02182) - 2099762..2099929 (-) 168 WP_172601651.1 hypothetical protein -
  FGL21_RS10505 (NCTC11554_02183) - 2099939..2100736 (-) 798 WP_138128223.1 PD-(D/E)XK nuclease-like domain-containing protein -
  FGL21_RS10510 (NCTC11554_02184) - 2100733..2101707 (-) 975 WP_138128225.1 RecT family recombinase -
  FGL21_RS11575 - 2101704..2101886 (-) 183 WP_138128227.1 hypothetical protein -
  FGL21_RS10520 (NCTC11554_02185) - 2101889..2102143 (-) 255 WP_138128229.1 hypothetical protein -
  FGL21_RS10525 (NCTC11554_02186) - 2102154..2102294 (-) 141 WP_011017992.1 hypothetical protein -
  FGL21_RS10530 (NCTC11554_02187) - 2102306..2102524 (-) 219 WP_136112612.1 hypothetical protein -
  FGL21_RS11465 (NCTC11554_02188) - 2102505..2103371 (-) 867 WP_138128231.1 DnaD domain protein -
  FGL21_RS10540 (NCTC11554_02189) - 2103487..2103930 (-) 444 WP_046176840.1 hypothetical protein -
  FGL21_RS10545 (NCTC11554_02190) - 2104102..2104281 (-) 180 WP_012560974.1 hypothetical protein -
  FGL21_RS10550 (NCTC11554_02191) - 2104417..2104611 (-) 195 WP_138128233.1 hypothetical protein -
  FGL21_RS10555 (NCTC11554_02192) - 2104608..2104883 (-) 276 WP_138128235.1 DNA-binding protein -
  FGL21_RS10560 - 2104941..2105126 (-) 186 WP_021340658.1 helix-turn-helix transcriptional regulator -
  FGL21_RS10565 (NCTC11554_02193) - 2105269..2105487 (+) 219 WP_032467270.1 hypothetical protein -
  FGL21_RS11535 (NCTC11554_02194) - 2105473..2105604 (-) 132 WP_002984298.1 hypothetical protein -
  FGL21_RS10570 (NCTC11554_02195) - 2105655..2106029 (+) 375 WP_023610946.1 DUF2513 domain-containing protein -
  FGL21_RS11305 (NCTC11554_02196) - 2106009..2106149 (-) 141 WP_003051781.1 hypothetical protein -
  FGL21_RS10575 (NCTC11554_02197) - 2106181..2106909 (-) 729 WP_138128237.1 phage antirepressor KilAC domain-containing protein -
  FGL21_RS10580 (NCTC11554_02198) - 2106940..2107140 (-) 201 WP_038433319.1 helix-turn-helix transcriptional regulator -
  FGL21_RS10585 (NCTC11554_02199) - 2107193..2107885 (+) 693 WP_138128239.1 DUF4145 domain-containing protein -
  FGL21_RS10590 (NCTC11554_02200) - 2107861..2108070 (-) 210 WP_138128241.1 hypothetical protein -
  FGL21_RS10595 (NCTC11554_02201) - 2108104..2108262 (-) 159 WP_138128244.1 hypothetical protein -
  FGL21_RS10600 (NCTC11554_02202) - 2108320..2108520 (+) 201 WP_138128246.1 KTSC domain-containing protein -
  FGL21_RS11310 (NCTC11554_02203) - 2108517..2108666 (-) 150 WP_172601652.1 hypothetical protein -
  FGL21_RS10605 (NCTC11554_02204) - 2109020..2109853 (+) 834 WP_138128248.1 helix-turn-helix transcriptional regulator -
  FGL21_RS10610 (NCTC11554_02205) - 2109889..2110782 (+) 894 WP_000426896.1 P63C domain-containing protein -
  FGL21_RS10615 (NCTC11554_02206) - 2110899..2111972 (+) 1074 WP_138128250.1 site-specific integrase -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6788.68 Da        Isoelectric Point: 3.9286

>NTDB_id=1127882 FGL21_RS10300 WP_138128179.1 2068314..2068496(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC11554]
MLTYDEFKQAIDDGYIVGDTVAIVRKDGQIFDYVLPGEPVRLWEVATEEKVEEVLGELGK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=1127882 FGL21_RS10300 WP_138128179.1 2068314..2068496(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC11554]
ATGCTAACATACGATGAGTTTAAGCAAGCGATCGATGACGGCTATATCGTAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAGG
TGTTGGGTGAATTAGGCAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS8232

80

100

0.8

  prx Streptococcus pyogenes MGAS315

80

100

0.8

  prx Streptococcus pyogenes MGAS315

71.667

100

0.717

  prx Streptococcus pyogenes MGAS315

71.667

100

0.717

  prx Streptococcus pyogenes MGAS315

92.683

68.333

0.633

  prx Streptococcus pyogenes MGAS315

87.805

68.333

0.6

  prx Streptococcus pyogenes MGAS315

78.049

68.333

0.533


Multiple sequence alignment