Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   FGL16_RS04575 Genome accession   NZ_LR594043
Coordinates   864699..864890 (+) Length   63 a.a.
NCBI ID   WP_024405272.1    Uniprot ID   -
Organism   Streptococcus suis strain NCTC10237     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 815674..864890 864699..864890 within 0


Gene organization within MGE regions


Location: 815674..864890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL16_RS04245 (NCTC10237_00818) parE 815674..817617 (+) 1944 WP_014735918.1 DNA topoisomerase IV subunit B -
  FGL16_RS04250 (NCTC10237_00819) - 817665..818009 (+) 345 WP_014735917.1 hypothetical protein -
  FGL16_RS04255 (NCTC10237_00820) - 818058..818660 (+) 603 WP_014735916.1 Fic family protein -
  FGL16_RS04260 (NCTC10237_00821) - 818693..819196 (+) 504 WP_014735915.1 YkvA family protein -
  FGL16_RS04265 (NCTC10237_00822) - 819225..819785 (+) 561 WP_014735914.1 GTP pyrophosphokinase -
  FGL16_RS04270 (NCTC10237_00823) - 819809..821155 (+) 1347 WP_014735913.1 hypothetical protein -
  FGL16_RS04275 (NCTC10237_00824) parC 821179..823632 (+) 2454 WP_014735912.1 DNA topoisomerase IV subunit A -
  FGL16_RS04280 (NCTC10237_00825) - 823853..824470 (+) 618 WP_014735911.1 DUF4230 domain-containing protein -
  FGL16_RS04285 (NCTC10237_00826) - 824581..825603 (+) 1023 WP_014735910.1 branched-chain amino acid aminotransferase -
  FGL16_RS04290 (NCTC10237_00827) - 825670..825903 (+) 234 WP_012775068.1 DUF2969 domain-containing protein -
  FGL16_RS04305 (NCTC10237_00830) rpsA 826506..827711 (+) 1206 WP_013730343.1 30S ribosomal protein S1 -
  FGL16_RS04315 (NCTC10237_00832) - 827892..828953 (-) 1062 WP_029694723.1 tyrosine-type recombinase/integrase -
  FGL16_RS04320 (NCTC10237_00833) - 829092..830108 (-) 1017 WP_024405314.1 Abi family protein -
  FGL16_RS04325 (NCTC10237_00834) - 830294..831052 (-) 759 WP_024405315.1 ImmA/IrrE family metallo-endopeptidase -
  FGL16_RS04330 (NCTC10237_00835) - 831055..831438 (-) 384 WP_024405316.1 helix-turn-helix transcriptional regulator -
  FGL16_RS10910 (NCTC10237_00836) - 831730..831870 (+) 141 WP_153308540.1 hypothetical protein -
  FGL16_RS10915 (NCTC10237_00837) - 831859..832026 (-) 168 WP_153308541.1 hypothetical protein -
  FGL16_RS04335 (NCTC10237_00838) - 832106..832471 (+) 366 WP_024405317.1 hypothetical protein -
  FGL16_RS04340 (NCTC10237_00839) - 832422..832616 (-) 195 WP_024405318.1 hypothetical protein -
  FGL16_RS04345 (NCTC10237_00840) - 832676..832888 (+) 213 WP_024381154.1 hypothetical protein -
  FGL16_RS04350 (NCTC10237_00841) - 832892..833089 (+) 198 WP_024405319.1 hypothetical protein -
  FGL16_RS04355 (NCTC10237_00843) - 833319..833573 (-) 255 WP_024405320.1 hypothetical protein -
  FGL16_RS10920 (NCTC10237_00844) - 833654..833815 (+) 162 WP_171009920.1 hypothetical protein -
  FGL16_RS04360 (NCTC10237_00846) - 833971..834660 (-) 690 WP_024405321.1 DUF4145 domain-containing protein -
  FGL16_RS04365 (NCTC10237_00847) - 834724..835449 (+) 726 WP_024405322.1 phage antirepressor KilAC domain-containing protein -
  FGL16_RS04370 (NCTC10237_00848) - 835497..835769 (+) 273 WP_024405323.1 hypothetical protein -
  FGL16_RS04375 (NCTC10237_00849) - 835779..835967 (+) 189 WP_024376894.1 hypothetical protein -
  FGL16_RS04380 (NCTC10237_00850) - 835969..836223 (+) 255 WP_024405324.1 hypothetical protein -
  FGL16_RS10925 (NCTC10237_00851) - 836226..836381 (+) 156 WP_153308542.1 hypothetical protein -
  FGL16_RS04385 (NCTC10237_00852) - 836374..837342 (+) 969 WP_024405325.1 phage replisome organizer N-terminal domain-containing protein -
  FGL16_RS04390 (NCTC10237_00853) - 837329..837520 (+) 192 WP_024405326.1 hypothetical protein -
  FGL16_RS10930 (NCTC10237_00854) - 837520..837690 (+) 171 WP_153308543.1 hypothetical protein -
  FGL16_RS04395 (NCTC10237_00855) - 837721..837963 (+) 243 WP_024405327.1 DUF3310 domain-containing protein -
  FGL16_RS04400 - 838084..839298 (+) 1215 Protein_774 DNA cytosine methyltransferase -
  FGL16_RS04405 (NCTC10237_00859) - 839291..839647 (+) 357 WP_024405328.1 hypothetical protein -
  FGL16_RS04410 (NCTC10237_00860) - 839640..840146 (+) 507 WP_024405329.1 DUF1642 domain-containing protein -
  FGL16_RS10935 (NCTC10237_00861) - 840136..840297 (+) 162 WP_002936922.1 hypothetical protein -
  FGL16_RS04415 (NCTC10237_00862) - 840686..841093 (+) 408 WP_024405330.1 YopX family protein -
  FGL16_RS04420 (NCTC10237_00863) - 841086..841295 (+) 210 WP_024405331.1 hypothetical protein -
  FGL16_RS04425 (NCTC10237_00864) - 841292..841495 (+) 204 WP_024405332.1 hypothetical protein -
  FGL16_RS04430 (NCTC10237_00866) ssbA 841763..842179 (+) 417 WP_024405334.1 single-stranded DNA-binding protein Machinery gene
  FGL16_RS04435 (NCTC10237_00867) - 842189..842452 (+) 264 WP_024405335.1 hypothetical protein -
  FGL16_RS04440 (NCTC10237_00868) - 842445..842837 (+) 393 WP_024405336.1 hypothetical protein -
  FGL16_RS10940 (NCTC10237_00869) - 842847..842987 (+) 141 WP_153308544.1 hypothetical protein -
  FGL16_RS04445 (NCTC10237_00870) - 843161..843562 (+) 402 WP_024402323.1 transcriptional regulator -
  FGL16_RS04450 (NCTC10237_00871) tnpA 843880..844344 (+) 465 WP_002939996.1 IS200/IS605-like element ISSsu4 family transposase -
  FGL16_RS04460 (NCTC10237_00872) - 844509..845051 (+) 543 WP_024405254.1 tyrosine-type recombinase/integrase -
  FGL16_RS04465 (NCTC10237_00874) - 845496..845795 (+) 300 Protein_788 HNH endonuclease -
  FGL16_RS04470 (NCTC10237_00875) - 845940..846329 (+) 390 WP_024405256.1 P27 family phage terminase small subunit -
  FGL16_RS04475 (NCTC10237_00876) - 846322..848118 (+) 1797 WP_024405257.1 terminase large subunit -
  FGL16_RS04480 (NCTC10237_00877) - 848141..849343 (+) 1203 WP_024405258.1 phage portal protein -
  FGL16_RS04485 (NCTC10237_00878) - 849330..849908 (+) 579 WP_024405259.1 HK97 family phage prohead protease -
  FGL16_RS04490 (NCTC10237_00879) - 849905..851083 (+) 1179 WP_024405260.1 phage major capsid protein -
  FGL16_RS04495 (NCTC10237_00880) - 851095..851439 (+) 345 WP_024405261.1 hypothetical protein -
  FGL16_RS04500 (NCTC10237_00881) - 851442..851723 (+) 282 WP_024405262.1 hypothetical protein -
  FGL16_RS04505 (NCTC10237_00882) - 851710..852009 (+) 300 WP_024405263.1 phage head closure protein -
  FGL16_RS04510 (NCTC10237_00883) - 852006..852359 (+) 354 WP_024405264.1 HK97 gp10 family phage protein -
  FGL16_RS04515 (NCTC10237_00884) - 852356..852586 (+) 231 WP_237658794.1 hypothetical protein -
  FGL16_RS04520 (NCTC10237_00885) - 852692..853267 (+) 576 WP_024405265.1 major tail protein -
  FGL16_RS04525 (NCTC10237_00886) - 853279..853698 (+) 420 WP_024390630.1 hypothetical protein -
  FGL16_RS04530 (NCTC10237_00887) - 854006..857026 (+) 3021 WP_024405266.1 phage tail tape measure protein -
  FGL16_RS04535 (NCTC10237_00888) - 857023..857745 (+) 723 WP_024405267.1 hypothetical protein -
  FGL16_RS04540 (NCTC10237_00889) - 857746..860025 (+) 2280 WP_074404474.1 phage tail spike protein -
  FGL16_RS11095 (NCTC10237_00890) - 860456..862282 (+) 1827 Protein_804 gp58-like family protein -
  FGL16_RS04555 (NCTC10237_00891) - 862291..862500 (+) 210 WP_024405268.1 hypothetical protein -
  FGL16_RS04560 (NCTC10237_00892) - 862503..862847 (+) 345 WP_024405269.1 hypothetical protein -
  FGL16_RS04565 (NCTC10237_00893) - 862893..863273 (+) 381 Protein_807 phage holin family protein -
  FGL16_RS10945 (NCTC10237_00895) - 863493..864332 (+) 840 WP_024405271.1 N-acetylmuramoyl-L-alanine amidase -
  FGL16_RS04575 (NCTC10237_00896) prx 864699..864890 (+) 192 WP_024405272.1 hypothetical protein Regulator

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7492.69 Da        Isoelectric Point: 4.6412

>NTDB_id=1127631 FGL16_RS04575 WP_024405272.1 864699..864890(+) (prx) [Streptococcus suis strain NCTC10237]
MLEYEELKQAVDDGYIKGDTVMIVRRDGKIFDYVLPGEEVRPWEVVREEKVVDVMRELKKHVI

Nucleotide


Download         Length: 192 bp        

>NTDB_id=1127631 FGL16_RS04575 WP_024405272.1 864699..864890(+) (prx) [Streptococcus suis strain NCTC10237]
ATGTTAGAATACGAAGAATTAAAACAAGCAGTAGATGACGGATATATCAAAGGCGACACGGTCATGATTGTTCGCAGGGA
CGGCAAGATATTTGATTATGTTTTGCCAGGCGAAGAGGTCAGACCATGGGAAGTGGTGAGAGAAGAGAAAGTAGTGGATG
TGATGAGGGAATTGAAAAAACATGTAATTTAG

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

66.667

95.238

0.635

  prx Streptococcus pyogenes MGAS315

63.333

95.238

0.603

  prx Streptococcus pyogenes MGAS8232

63.333

95.238

0.603

  prx Streptococcus pyogenes MGAS315

58.333

95.238

0.556

  prx Streptococcus pyogenes MGAS315

73.81

66.667

0.492

  prx Streptococcus pyogenes MGAS315

75.61

65.079

0.492

  prx Streptococcus pyogenes MGAS315

68.293

65.079

0.444


Multiple sequence alignment