Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FGK81_RS03760 | Genome accession | NZ_LR590466 |
| Coordinates | 725335..725517 (+) | Length | 60 a.a. |
| NCBI ID | WP_011888783.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8193 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 687919..725517 | 725335..725517 | within | 0 |
Gene organization within MGE regions
Location: 687919..725517
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGK81_RS03465 (NCTC8193_00687) | - | 687937..688779 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| FGK81_RS03470 (NCTC8193_00688) | - | 688757..689344 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| FGK81_RS03475 (NCTC8193_00689) | - | 689443..689718 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| FGK81_RS03480 (NCTC8193_00690) | - | 689808..690950 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| FGK81_RS03485 (NCTC8193_00691) | - | 691074..691340 (-) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| FGK81_RS03490 (NCTC8193_00692) | - | 691352..691738 (-) | 387 | WP_011888747.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FGK81_RS03495 (NCTC8193_00693) | - | 691741..692091 (-) | 351 | WP_011888748.1 | helix-turn-helix domain-containing protein | - |
| FGK81_RS03500 (NCTC8193_00694) | - | 692399..692614 (+) | 216 | WP_011888749.1 | hypothetical protein | - |
| FGK81_RS10105 (NCTC8193_00695) | - | 692627..692761 (+) | 135 | WP_011888750.1 | hypothetical protein | - |
| FGK81_RS03510 | - | 693124..693309 (+) | 186 | WP_011888751.1 | helix-turn-helix domain-containing protein | - |
| FGK81_RS03515 (NCTC8193_00696) | - | 693388..693699 (+) | 312 | WP_002990080.1 | hypothetical protein | - |
| FGK81_RS03520 (NCTC8193_00697) | - | 693701..693886 (+) | 186 | WP_011888752.1 | hypothetical protein | - |
| FGK81_RS09985 | - | 693980..694249 (+) | 270 | WP_038433488.1 | replication protein | - |
| FGK81_RS03530 (NCTC8193_00698) | - | 694404..694790 (+) | 387 | WP_002985388.1 | DnaD domain-containing protein | - |
| FGK81_RS03535 (NCTC8193_00699) | - | 694771..695004 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| FGK81_RS03540 (NCTC8193_00700) | - | 695001..695141 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| FGK81_RS03545 (NCTC8193_00701) | - | 695150..695356 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| FGK81_RS03550 (NCTC8193_00702) | - | 695412..695741 (+) | 330 | WP_011888754.1 | hypothetical protein | - |
| FGK81_RS03555 (NCTC8193_00703) | bet | 695744..696520 (+) | 777 | WP_011888755.1 | phage recombination protein Bet | - |
| FGK81_RS03560 (NCTC8193_00704) | - | 696530..697558 (+) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| FGK81_RS03565 (NCTC8193_00705) | - | 697754..698095 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| FGK81_RS03570 (NCTC8193_00706) | - | 698092..698604 (+) | 513 | WP_011888758.1 | hypothetical protein | - |
| FGK81_RS09990 (NCTC8193_00707) | - | 698591..698776 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| FGK81_RS03580 | - | 698855..699046 (+) | 192 | WP_414820253.1 | hypothetical protein | - |
| FGK81_RS03585 (NCTC8193_00708) | - | 699036..699800 (+) | 765 | WP_011888760.1 | DNA-methyltransferase | - |
| FGK81_RS03590 (NCTC8193_00709) | - | 699926..700141 (+) | 216 | WP_032463293.1 | hypothetical protein | - |
| FGK81_RS03595 (NCTC8193_00710) | - | 700138..700659 (+) | 522 | WP_011888762.1 | DUF1642 domain-containing protein | - |
| FGK81_RS09805 (NCTC8193_00711) | - | 700656..700826 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| FGK81_RS03600 (NCTC8193_00712) | - | 701093..701512 (+) | 420 | WP_011888763.1 | DUF1492 domain-containing protein | - |
| FGK81_RS03605 | - | 701621..701965 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| FGK81_RS03610 (NCTC8193_00713) | - | 702114..702470 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| FGK81_RS03615 (NCTC8193_00714) | - | 702467..703735 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| FGK81_RS03620 (NCTC8193_00715) | - | 703728..705221 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| FGK81_RS03625 (NCTC8193_00716) | - | 705227..705451 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| FGK81_RS09810 (NCTC8193_00717) | - | 705528..705680 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| FGK81_RS03630 (NCTC8193_00718) | - | 705673..705939 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| FGK81_RS03635 (NCTC8193_00719) | - | 705941..706177 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| FGK81_RS03640 (NCTC8193_00720) | - | 706259..707674 (+) | 1416 | WP_011888765.1 | terminase | - |
| FGK81_RS03645 (NCTC8193_00721) | - | 707745..708206 (+) | 462 | WP_011888766.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| FGK81_RS03650 (NCTC8193_00722) | - | 708231..709142 (+) | 912 | WP_011888767.1 | phage major capsid protein | - |
| FGK81_RS03655 (NCTC8193_00723) | - | 709142..709342 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| FGK81_RS03660 (NCTC8193_00724) | - | 709352..709774 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| FGK81_RS03665 (NCTC8193_00725) | - | 709734..710072 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| FGK81_RS03670 (NCTC8193_00726) | - | 710065..710301 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| FGK81_RS03675 (NCTC8193_00727) | - | 710302..710637 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| FGK81_RS03680 (NCTC8193_00728) | - | 710649..711227 (+) | 579 | WP_011888768.1 | hypothetical protein | - |
| FGK81_RS03685 (NCTC8193_00729) | - | 711238..711501 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| FGK81_RS03690 (NCTC8193_00730) | - | 711516..711887 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| FGK81_RS03695 (NCTC8193_00731) | - | 711887..714244 (+) | 2358 | WP_011888769.1 | hypothetical protein | - |
| FGK81_RS03700 (NCTC8193_00732) | - | 714241..714936 (+) | 696 | WP_011888770.1 | hypothetical protein | - |
| FGK81_RS03705 (NCTC8193_00733) | - | 714918..716894 (+) | 1977 | WP_041174190.1 | phage tail spike protein | - |
| FGK81_RS03710 (NCTC8193_00734) | hylP | 716891..717907 (+) | 1017 | WP_011888772.1 | hyaluronidase HylP | - |
| FGK81_RS03715 (NCTC8193_00735) | - | 717922..719706 (+) | 1785 | WP_011888773.1 | gp58-like family protein | - |
| FGK81_RS03720 (NCTC8193_00736) | - | 719718..720146 (+) | 429 | WP_011888774.1 | DUF1617 family protein | - |
| FGK81_RS03725 (NCTC8193_00737) | - | 720149..720781 (+) | 633 | WP_011888775.1 | hypothetical protein | - |
| FGK81_RS03730 (NCTC8193_00738) | - | 720792..721091 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| FGK81_RS03735 (NCTC8193_00739) | - | 721088..721273 (+) | 186 | WP_011888776.1 | holin | - |
| FGK81_RS03740 (NCTC8193_00741) | - | 721387..722604 (+) | 1218 | WP_023077240.1 | peptidoglycan amidohydrolase family protein | - |
| FGK81_RS03745 (NCTC8193_00742) | - | 722898..723869 (+) | 972 | WP_011888780.1 | Abi family protein | - |
| FGK81_RS03750 (NCTC8193_00743) | - | 724053..724253 (+) | 201 | WP_011888781.1 | CsbD family protein | - |
| FGK81_RS03755 (NCTC8193_00744) | - | 724475..725269 (+) | 795 | WP_011888782.1 | DNA/RNA non-specific endonuclease | - |
| FGK81_RS03760 (NCTC8193_00745) | prx | 725335..725517 (+) | 183 | WP_011888783.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.3455
>NTDB_id=1126779 FGK81_RS03760 WP_011888783.1 725335..725517(+) (prx) [Streptococcus pyogenes strain NCTC8193]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1126779 FGK81_RS03760 WP_011888783.1 725335..725517(+) (prx) [Streptococcus pyogenes strain NCTC8193]
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
93.333 |
100 |
0.933 |
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |