Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FGK81_RS03015 | Genome accession | NZ_LR590466 |
| Coordinates | 589429..589611 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8193 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 548524..589611 | 589429..589611 | within | 0 |
Gene organization within MGE regions
Location: 548524..589611
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGK81_RS02735 (NCTC8193_00537) | - | 548524..549609 (-) | 1086 | WP_011888676.1 | tyrosine-type recombinase/integrase | - |
| FGK81_RS02740 (NCTC8193_00538) | - | 549791..551212 (-) | 1422 | WP_011888677.1 | DUF4041 domain-containing protein | - |
| FGK81_RS02745 (NCTC8193_00539) | - | 551227..551613 (-) | 387 | WP_041174188.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FGK81_RS02750 (NCTC8193_00540) | - | 551597..551938 (-) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| FGK81_RS02755 (NCTC8193_00541) | - | 552136..552348 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| FGK81_RS02760 (NCTC8193_00542) | - | 552376..553095 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| FGK81_RS02765 (NCTC8193_00543) | - | 553193..553432 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| FGK81_RS02770 (NCTC8193_00544) | - | 553599..553784 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| FGK81_RS02775 (NCTC8193_00545) | - | 553855..554106 (+) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| FGK81_RS02780 (NCTC8193_00546) | - | 554137..554274 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| FGK81_RS02785 (NCTC8193_00548) | - | 554368..555084 (+) | 717 | WP_011888683.1 | DnaD domain protein | - |
| FGK81_RS02790 (NCTC8193_00549) | - | 555071..555853 (+) | 783 | WP_011888684.1 | ATP-binding protein | - |
| FGK81_RS02795 (NCTC8193_00551) | - | 555994..556347 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| FGK81_RS02800 (NCTC8193_00552) | - | 556328..556582 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| FGK81_RS02805 (NCTC8193_00553) | - | 556604..557086 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| FGK81_RS10175 | - | 557087..557752 (+) | 666 | Protein_505 | ERF family protein | - |
| FGK81_RS09920 | ssb | 557753..558178 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| FGK81_RS02815 | - | 558184..558387 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| FGK81_RS02820 (NCTC8193_00555) | - | 558387..558827 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FGK81_RS02825 (NCTC8193_00556) | - | 558824..559180 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| FGK81_RS10140 (NCTC8193_00557) | - | 559177..559422 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| FGK81_RS02835 (NCTC8193_00558) | - | 559422..559658 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| FGK81_RS09790 (NCTC8193_00559) | - | 559655..559825 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| FGK81_RS02840 (NCTC8193_00560) | - | 559822..560106 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| FGK81_RS02845 (NCTC8193_00561) | - | 560108..560740 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| FGK81_RS02850 (NCTC8193_00562) | - | 560745..561224 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| FGK81_RS09795 (NCTC8193_00563) | - | 561221..561391 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| FGK81_RS02855 (NCTC8193_00564) | - | 561675..562109 (+) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FGK81_RS02870 (NCTC8193_00565) | - | 562743..563909 (+) | 1167 | Protein_518 | DNA modification methylase | - |
| FGK81_RS02875 (NCTC8193_00567) | - | 564253..564729 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| FGK81_RS09975 (NCTC8193_00568) | - | 564812..565423 (+) | 612 | WP_232036056.1 | terminase large subunit domain-containing protein | - |
| FGK81_RS09980 (NCTC8193_00569) | - | 565392..566024 (+) | 633 | WP_229310080.1 | hypothetical protein | - |
| FGK81_RS02885 (NCTC8193_00570) | - | 566038..567540 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| FGK81_RS02890 (NCTC8193_00572) | - | 567545..569038 (+) | 1494 | Protein_523 | phage minor capsid protein | - |
| FGK81_RS02895 (NCTC8193_00573) | - | 569038..569265 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| FGK81_RS02900 (NCTC8193_00574) | - | 569352..569618 (+) | 267 | WP_011888689.1 | hypothetical protein | - |
| FGK81_RS02905 (NCTC8193_00575) | - | 569744..570358 (+) | 615 | WP_011888690.1 | hypothetical protein | - |
| FGK81_RS02910 (NCTC8193_00576) | - | 570362..571180 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| FGK81_RS02915 (NCTC8193_00577) | - | 571234..571650 (+) | 417 | WP_011888692.1 | hypothetical protein | - |
| FGK81_RS02920 (NCTC8193_00578) | - | 571640..571972 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| FGK81_RS02925 (NCTC8193_00579) | - | 571972..572328 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| FGK81_RS02930 (NCTC8193_00580) | - | 572325..572723 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| FGK81_RS02935 (NCTC8193_00581) | - | 572723..573184 (+) | 462 | WP_011018120.1 | phage tail tube protein | - |
| FGK81_RS02940 (NCTC8193_00582) | - | 573228..573662 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| FGK81_RS02945 (NCTC8193_00583) | - | 573666..574247 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| FGK81_RS02950 (NCTC8193_00584) | - | 574237..577497 (+) | 3261 | WP_023077751.1 | tape measure protein | - |
| FGK81_RS02955 (NCTC8193_00585) | - | 577494..578210 (+) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| FGK81_RS02960 (NCTC8193_00586) | - | 578207..580351 (+) | 2145 | WP_011888698.1 | phage tail spike protein | - |
| FGK81_RS02965 (NCTC8193_00587) | - | 580348..581358 (+) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| FGK81_RS02970 (NCTC8193_00588) | - | 581371..583257 (+) | 1887 | WP_011527561.1 | gp58-like family protein | - |
| FGK81_RS02975 (NCTC8193_00589) | - | 583269..583700 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| FGK81_RS02980 (NCTC8193_00590) | - | 583703..584335 (+) | 633 | WP_011888699.1 | hypothetical protein | - |
| FGK81_RS02985 (NCTC8193_00591) | - | 584345..584800 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| FGK81_RS10095 (NCTC8193_00592) | - | 584802..584924 (+) | 123 | WP_029713948.1 | hypothetical protein | - |
| FGK81_RS02990 (NCTC8193_00593) | - | 584912..586117 (+) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| FGK81_RS02995 (NCTC8193_00594) | - | 586257..586781 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| FGK81_RS03000 (NCTC8193_00595) | - | 586769..587635 (+) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| FGK81_RS03005 (NCTC8193_00596) | - | 587685..588119 (-) | 435 | WP_011888702.1 | hypothetical protein | - |
| FGK81_RS03010 (NCTC8193_00597) | sda3 | 588391..589191 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| FGK81_RS03015 (NCTC8193_00598) | prx | 589429..589611 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=1126776 FGK81_RS03015 WP_011184907.1 589429..589611(+) (prx) [Streptococcus pyogenes strain NCTC8193]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1126776 FGK81_RS03015 WP_011184907.1 589429..589611(+) (prx) [Streptococcus pyogenes strain NCTC8193]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |