Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | E0F32_RS11165 | Genome accession | NZ_LR216050 |
| Coordinates | 2056116..2056241 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2051116..2061241
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0F32_RS12320 | - | 2051454..2053057 (-) | 1604 | Protein_2074 | YhgE/Pip family protein | - |
| E0F32_RS11140 (SAMEA3431333_02090) | - | 2053236..2053778 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| E0F32_RS11155 (SAMEA3431333_02093) | comE | 2054021..2054773 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| E0F32_RS11160 (SAMEA3431333_02094) | comD/comD2 | 2054770..2056095 (-) | 1326 | WP_001842237.1 | competence system sensor histidine kinase ComD | Regulator |
| E0F32_RS11165 (SAMEA3431333_02095) | comC/comC2 | 2056116..2056241 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| E0F32_RS11175 (SAMEA3431333_02097) | rlmH | 2056523..2057002 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| E0F32_RS11180 (SAMEA3431333_02098) | htrA | 2057185..2058366 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| E0F32_RS11185 (SAMEA3431333_02099) | spo0J | 2058424..2059182 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| E0F32_RS11190 (SAMEA3431333_02100) | dnaA | 2059395..2060756 (+) | 1362 | WP_000660618.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=1126160 E0F32_RS11165 WP_000799694.1 2056116..2056241(-) (comC/comC2) [Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1126160 E0F32_RS11165 WP_000799694.1 2056116..2056241(-) (comC/comC2) [Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |