Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | YBT1520_RS27380 | Genome accession | NZ_CP004858 |
| Coordinates | 5236490..5237071 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis serovar kurstaki str. YBT-1520 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5194458..5237071 | 5236490..5237071 | within | 0 |
Gene organization within MGE regions
Location: 5194458..5237071
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| YBT1520_RS27075 (YBT1520_27145) | - | 5194458..5194703 (-) | 246 | WP_000869730.1 | glutaredoxin family protein | - |
| YBT1520_RS27080 (YBT1520_27150) | rpoN | 5194713..5196020 (-) | 1308 | WP_000647955.1 | RNA polymerase factor sigma-54 | - |
| YBT1520_RS27085 (YBT1520_27155) | - | 5196587..5197420 (+) | 834 | WP_038413978.1 | hypothetical protein | - |
| YBT1520_RS27090 (YBT1520_27160) | - | 5197513..5197756 (+) | 244 | Protein_5275 | helix-turn-helix domain-containing protein | - |
| YBT1520_RS27095 (YBT1520_27165) | - | 5197734..5197982 (+) | 249 | WP_038413806.1 | hypothetical protein | - |
| YBT1520_RS27100 (YBT1520_27170) | - | 5198061..5198393 (+) | 333 | WP_038413808.1 | hypothetical protein | - |
| YBT1520_RS27105 (YBT1520_27175) | - | 5198572..5199624 (-) | 1053 | WP_038413809.1 | N-acetylmuramoyl-L-alanine amidase | - |
| YBT1520_RS27110 (YBT1520_27180) | - | 5199621..5199824 (-) | 204 | WP_038413810.1 | hypothetical protein | - |
| YBT1520_RS27115 (YBT1520_27185) | - | 5199826..5200035 (-) | 210 | WP_038413980.1 | hemolysin XhlA family protein | - |
| YBT1520_RS27120 (YBT1520_27190) | - | 5200085..5201365 (-) | 1281 | WP_038413811.1 | BppU family phage baseplate upper protein | - |
| YBT1520_RS35810 (YBT1520_27195) | - | 5201380..5203722 (-) | 2343 | WP_038413812.1 | phage tail spike protein | - |
| YBT1520_RS27130 (YBT1520_27200) | - | 5203719..5204402 (-) | 684 | WP_038413814.1 | phage tail domain-containing protein | - |
| YBT1520_RS27135 (YBT1520_27205) | - | 5204404..5207925 (-) | 3522 | WP_038413816.1 | phage tail tape measure protein | - |
| YBT1520_RS27140 (YBT1520_27215) | - | 5208169..5208555 (-) | 387 | WP_000113342.1 | hypothetical protein | - |
| YBT1520_RS27145 (YBT1520_27220) | - | 5208567..5209202 (-) | 636 | WP_038413819.1 | major tail protein | - |
| YBT1520_RS27150 (YBT1520_27225) | - | 5209214..5209591 (-) | 378 | WP_038413820.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| YBT1520_RS27155 (YBT1520_27230) | - | 5209591..5209920 (-) | 330 | WP_038413822.1 | hypothetical protein | - |
| YBT1520_RS27160 (YBT1520_27235) | - | 5209910..5210245 (-) | 336 | WP_038413824.1 | phage protein | - |
| YBT1520_RS27165 (YBT1520_27240) | - | 5210220..5210480 (-) | 261 | WP_038413826.1 | head-tail connector protein | - |
| YBT1520_RS27170 (YBT1520_27245) | - | 5210482..5211849 (-) | 1368 | WP_038413828.1 | phage major capsid protein | - |
| YBT1520_RS27175 (YBT1520_27250) | - | 5211851..5212429 (-) | 579 | WP_038413830.1 | HK97 family phage prohead protease | - |
| YBT1520_RS27180 (YBT1520_27255) | - | 5212398..5213603 (-) | 1206 | WP_038413832.1 | phage portal protein | - |
| YBT1520_RS27185 (YBT1520_27260) | - | 5213619..5215346 (-) | 1728 | WP_038413833.1 | terminase TerL endonuclease subunit | - |
| YBT1520_RS27190 (YBT1520_27265) | - | 5215343..5215780 (-) | 438 | WP_038413835.1 | P27 family phage terminase small subunit | - |
| YBT1520_RS27195 (YBT1520_27270) | - | 5215865..5216257 (-) | 393 | WP_038413837.1 | HNH endonuclease signature motif containing protein | - |
| YBT1520_RS27200 (YBT1520_27275) | - | 5216254..5216577 (-) | 324 | WP_038413839.1 | phage protein | - |
| YBT1520_RS27205 (YBT1520_27280) | - | 5216574..5216795 (-) | 222 | WP_038413841.1 | hypothetical protein | - |
| YBT1520_RS27210 | - | 5216841..5217038 (-) | 198 | WP_038413982.1 | hypothetical protein | - |
| YBT1520_RS36360 (YBT1520_27290) | - | 5217179..5217349 (-) | 171 | WP_172965765.1 | hypothetical protein | - |
| YBT1520_RS27215 (YBT1520_27295) | - | 5217662..5218051 (-) | 390 | WP_038413842.1 | DUF3942 family protein | - |
| YBT1520_RS27220 (YBT1520_27300) | - | 5218251..5218637 (-) | 387 | WP_038413844.1 | phage protein | - |
| YBT1520_RS35815 (YBT1520_27305) | - | 5218679..5218852 (-) | 174 | WP_198319674.1 | DUF6877 family protein | - |
| YBT1520_RS27225 (YBT1520_27310) | - | 5219026..5219325 (-) | 300 | WP_038413846.1 | hypothetical protein | - |
| YBT1520_RS27230 (YBT1520_27315) | - | 5219361..5219624 (-) | 264 | WP_001216580.1 | hypothetical protein | - |
| YBT1520_RS27235 (YBT1520_27320) | - | 5219694..5220131 (-) | 438 | WP_000169951.1 | hypothetical protein | - |
| YBT1520_RS27240 (YBT1520_27325) | - | 5220183..5220455 (-) | 273 | WP_000331834.1 | hypothetical protein | - |
| YBT1520_RS27245 (YBT1520_27330) | - | 5220457..5220996 (-) | 540 | WP_000617754.1 | ERCC4 domain-containing protein | - |
| YBT1520_RS27250 (YBT1520_27335) | - | 5220993..5221367 (-) | 375 | WP_080703607.1 | YopX family protein | - |
| YBT1520_RS27255 (YBT1520_27340) | - | 5221370..5221798 (-) | 429 | WP_038413852.1 | hypothetical protein | - |
| YBT1520_RS27260 (YBT1520_27345) | - | 5222064..5224418 (-) | 2355 | WP_038413854.1 | phage/plasmid primase, P4 family | - |
| YBT1520_RS27265 (YBT1520_27350) | - | 5224415..5224795 (-) | 381 | WP_038413856.1 | zinc-finger-containing protein | - |
| YBT1520_RS27270 (YBT1520_27355) | - | 5224862..5225341 (-) | 480 | WP_038413858.1 | DUF669 domain-containing protein | - |
| YBT1520_RS27275 (YBT1520_27360) | - | 5225341..5226033 (-) | 693 | WP_038413860.1 | AAA family ATPase | - |
| YBT1520_RS27280 (YBT1520_27365) | - | 5226049..5226645 (-) | 597 | WP_038413862.1 | hypothetical protein | - |
| YBT1520_RS27285 (YBT1520_27370) | - | 5226648..5227199 (-) | 552 | WP_038413864.1 | host-nuclease inhibitor Gam family protein | - |
| YBT1520_RS27290 (YBT1520_27375) | - | 5227177..5227458 (-) | 282 | WP_038413866.1 | hypothetical protein | - |
| YBT1520_RS27295 (YBT1520_27380) | - | 5227458..5227661 (-) | 204 | WP_038413868.1 | hypothetical protein | - |
| YBT1520_RS36365 (YBT1520_27385) | - | 5227677..5227832 (-) | 156 | WP_021727747.1 | hypothetical protein | - |
| YBT1520_RS27300 (YBT1520_27390) | - | 5227895..5228542 (-) | 648 | WP_003280171.1 | sigma-70 family RNA polymerase sigma factor | - |
| YBT1520_RS27305 (YBT1520_27395) | - | 5228563..5228913 (-) | 351 | WP_001209506.1 | hypothetical protein | - |
| YBT1520_RS27310 (YBT1520_27400) | - | 5228914..5229141 (-) | 228 | WP_038413873.1 | hypothetical protein | - |
| YBT1520_RS36370 | - | 5229142..5229309 (-) | 168 | WP_172965764.1 | hypothetical protein | - |
| YBT1520_RS27315 (YBT1520_27405) | - | 5229368..5229601 (-) | 234 | WP_023523446.1 | DUF771 domain-containing protein | - |
| YBT1520_RS27320 (YBT1520_27410) | - | 5229636..5229866 (-) | 231 | WP_000216290.1 | helix-turn-helix transcriptional regulator | - |
| YBT1520_RS27325 (YBT1520_27415) | - | 5230031..5230423 (+) | 393 | WP_023523448.1 | helix-turn-helix transcriptional regulator | - |
| YBT1520_RS27330 (YBT1520_27420) | - | 5230434..5230901 (+) | 468 | WP_038413877.1 | hypothetical protein | - |
| YBT1520_RS27335 (YBT1520_27425) | - | 5230932..5232068 (+) | 1137 | WP_038413879.1 | tyrosine-type recombinase/integrase | - |
| YBT1520_RS27345 (YBT1520_27430) | - | 5232483..5232689 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| YBT1520_RS27350 (YBT1520_27435) | - | 5232783..5233271 (+) | 489 | WP_001226064.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| YBT1520_RS27355 (YBT1520_27440) | spoVAC | 5233301..5233777 (+) | 477 | WP_000095408.1 | stage V sporulation protein AC | - |
| YBT1520_RS27360 (YBT1520_27445) | spoVAD | 5233778..5234794 (+) | 1017 | WP_000938972.1 | stage V sporulation protein AD | - |
| YBT1520_RS27365 (YBT1520_27450) | spoVAE | 5234791..5235141 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| YBT1520_RS27370 (YBT1520_27455) | - | 5235153..5235359 (+) | 207 | WP_000215909.1 | DUF1657 domain-containing protein | - |
| YBT1520_RS27375 (YBT1520_27460) | - | 5235380..5236249 (+) | 870 | WP_000018924.1 | DUF421 domain-containing protein | - |
| YBT1520_RS27380 (YBT1520_27465) | clpP | 5236490..5237071 (+) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=112452 YBT1520_RS27380 WP_001049162.1 5236490..5237071(+) (clpP) [Bacillus thuringiensis serovar kurstaki str. YBT-1520]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=112452 YBT1520_RS27380 WP_001049162.1 5236490..5237071(+) (clpP) [Bacillus thuringiensis serovar kurstaki str. YBT-1520]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |