Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | EL140_RS09540 | Genome accession | NZ_LR134336 |
| Coordinates | 1928248..1928373 (-) | Length | 41 a.a. |
| NCBI ID | WP_002874960.1 | Uniprot ID | O33689 |
| Organism | Streptococcus oralis ATCC 35037 strain NCTC 11427 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1923248..1933373
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL140_RS09515 (NCTC11427_01882) | - | 1925379..1925921 (+) | 543 | WP_000665080.1 | TetR/AcrR family transcriptional regulator | - |
| EL140_RS09530 (NCTC11427_01885) | comE | 1926159..1926911 (-) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| EL140_RS09535 (NCTC11427_01886) | comD | 1926908..1928227 (-) | 1320 | WP_000054555.1 | competence system sensor histidine kinase ComD | Regulator |
| EL140_RS09540 (NCTC11427_01887) | comC/comC1 | 1928248..1928373 (-) | 126 | WP_002874960.1 | competence-stimulating peptide ComC | Regulator |
| EL140_RS09550 (NCTC11427_01889) | rlmH | 1928655..1929134 (-) | 480 | WP_000694221.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| EL140_RS09555 (NCTC11427_01890) | htrA | 1929320..1930516 (+) | 1197 | WP_000681805.1 | S1C family serine protease | Regulator |
| EL140_RS09560 (NCTC11427_01891) | spo0J | 1930574..1931332 (+) | 759 | WP_000410357.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4987.71 Da Isoelectric Point: 9.8680
>NTDB_id=1121878 EL140_RS09540 WP_002874960.1 1928248..1928373(-) (comC/comC1) [Streptococcus oralis ATCC 35037 strain NCTC 11427]
MKNTEKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
MKNTEKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
Nucleotide
Download Length: 126 bp
>NTDB_id=1121878 EL140_RS09540 WP_002874960.1 1928248..1928373(-) (comC/comC1) [Streptococcus oralis ATCC 35037 strain NCTC 11427]
ATGAAAAATACAGAAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
ATGAAAAATACAGAAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis SK321 |
65.517 |
70.732 |
0.463 |
| comC/comC2 | Streptococcus pneumoniae A66 |
55.172 |
70.732 |
0.39 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
55.172 |
70.732 |
0.39 |
| comC/blpC | Streptococcus mutans UA159 |
44.118 |
82.927 |
0.366 |