Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   EL136_RS04295 Genome accession   NZ_LR134317
Coordinates   896267..896455 (-) Length   62 a.a.
NCBI ID   WP_037578450.1    Uniprot ID   A0A922NVX2
Organism   Streptococcus equi subsp. zooepidemicus strain NCTC6180     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 888696..935240 896267..896455 within 0


Gene organization within MGE regions


Location: 888696..935240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL136_RS04260 (NCTC6180_00875) pfkA 888696..889709 (-) 1014 WP_012515510.1 6-phosphofructokinase -
  EL136_RS04265 (NCTC6180_00876) - 889789..892899 (-) 3111 WP_154803882.1 DNA polymerase III subunit alpha -
  EL136_RS04270 (NCTC6180_00877) - 893141..893512 (+) 372 WP_012515508.1 GntR family transcriptional regulator -
  EL136_RS04275 (NCTC6180_00878) - 893512..894210 (+) 699 WP_012515507.1 ABC transporter ATP-binding protein -
  EL136_RS04280 (NCTC6180_00879) - 894220..895014 (+) 795 WP_154803883.1 ABC transporter permease -
  EL136_RS04285 (NCTC6180_00880) - 895061..895672 (-) 612 WP_154803884.1 TVP38/TMEM64 family protein -
  EL136_RS04295 (NCTC6180_00882) prx 896267..896455 (-) 189 WP_037578450.1 hypothetical protein Regulator
  EL136_RS04300 (NCTC6180_00883) - 896695..897846 (+) 1152 WP_037578452.1 DNA/RNA non-specific endonuclease -
  EL136_RS04305 (NCTC6180_00884) - 897960..898823 (-) 864 WP_037578454.1 hypothetical protein -
  EL136_RS04310 (NCTC6180_00885) - 898811..899335 (-) 525 WP_037578457.1 Panacea domain-containing protein -
  EL136_RS04315 - 899411..900981 (+) 1571 WP_154803599.1 IS3 family transposase -
  EL136_RS04320 (NCTC6180_00888) - 901173..901787 (-) 615 WP_154803885.1 hypothetical protein -
  EL136_RS04325 (NCTC6180_00889) - 901789..902211 (-) 423 WP_232013953.1 collagen-like protein -
  EL136_RS04330 (NCTC6180_00890) - 902221..902994 (-) 774 WP_138119235.1 hypothetical protein -
  EL136_RS04335 (NCTC6180_00891) - 903005..903607 (-) 603 WP_154803886.1 hypothetical protein -
  EL136_RS04340 (NCTC6180_00892) - 903619..904383 (-) 765 WP_154803887.1 CHAP domain-containing protein -
  EL136_RS04345 (NCTC6180_00893) - 904385..904720 (-) 336 WP_154803888.1 phage holin family protein -
  EL136_RS04350 (NCTC6180_00894) - 904722..905021 (-) 300 WP_154803889.1 hypothetical protein -
  EL136_RS11265 (NCTC6180_00895) - 905034..905156 (-) 123 WP_269206307.1 hypothetical protein -
  EL136_RS04355 (NCTC6180_00896) - 905170..905520 (-) 351 WP_154803890.1 DUF1366 domain-containing protein -
  EL136_RS04360 (NCTC6180_00897) - 905531..907387 (-) 1857 WP_154803891.1 DUF859 family phage minor structural protein -
  EL136_RS04365 (NCTC6180_00898) - 907392..910823 (-) 3432 WP_154803892.1 phage tail protein -
  EL136_RS04370 (NCTC6180_00899) - 910824..912305 (-) 1482 WP_154803893.1 distal tail protein Dit -
  EL136_RS04375 (NCTC6180_00900) - 912306..914111 (-) 1806 WP_154803894.1 phage tail protein -
  EL136_RS04380 (NCTC6180_00901) - 914104..914562 (-) 459 WP_138119215.1 hypothetical protein -
  EL136_RS04385 (NCTC6180_00902) - 914535..914852 (-) 318 WP_138119213.1 hypothetical protein -
  EL136_RS04390 (NCTC6180_00903) - 914864..915370 (-) 507 WP_138119211.1 phage major tail protein, TP901-1 family -
  EL136_RS04395 (NCTC6180_00904) - 915383..915793 (-) 411 WP_138119209.1 DUF5072 family protein -
  EL136_RS04400 (NCTC6180_00905) - 915795..916190 (-) 396 WP_138119207.1 hypothetical protein -
  EL136_RS04405 (NCTC6180_00906) - 916187..916498 (-) 312 WP_138119206.1 hypothetical protein -
  EL136_RS04410 (NCTC6180_00907) - 916495..916839 (-) 345 WP_138119204.1 phage head-tail connector protein -
  EL136_RS04415 (NCTC6180_00908) - 916853..917146 (-) 294 WP_138119202.1 HeH/LEM domain-containing protein -
  EL136_RS04420 (NCTC6180_00909) - 917160..918050 (-) 891 WP_154803895.1 phage capsid protein -
  EL136_RS04425 (NCTC6180_00910) - 918070..918639 (-) 570 WP_138119199.1 DUF4355 domain-containing protein -
  EL136_RS04430 (NCTC6180_00912) - 918967..919875 (-) 909 WP_138119197.1 minor capsid protein -
  EL136_RS04435 (NCTC6180_00913) - 919868..921169 (-) 1302 WP_138119195.1 phage portal protein -
  EL136_RS04440 (NCTC6180_00914) - 921169..922443 (-) 1275 WP_138119193.1 PBSX family phage terminase large subunit -
  EL136_RS04445 (NCTC6180_00915) - 922433..922771 (-) 339 WP_138119191.1 phBC6A51 family helix-turn-helix protein -
  EL136_RS04450 (NCTC6180_00916) - 922844..923101 (-) 258 WP_138119189.1 type II toxin-antitoxin system RelE family toxin -
  EL136_RS04455 (NCTC6180_00917) relB 923098..923331 (-) 234 WP_138119187.1 type II toxin-antitoxin system RelB family antitoxin -
  EL136_RS04460 (NCTC6180_00918) - 923501..923938 (-) 438 WP_138119185.1 DUF1492 domain-containing protein -
  EL136_RS04465 (NCTC6180_00919) - 924130..924465 (-) 336 WP_154803896.1 hypothetical protein -
  EL136_RS11305 - 924440..924604 (-) 165 Protein_882 DUF1642 domain-containing protein -
  EL136_RS11110 (NCTC6180_00920) - 924648..924842 (-) 195 WP_138119181.1 hypothetical protein -
  EL136_RS04475 (NCTC6180_00921) - 924829..925341 (-) 513 WP_138119179.1 crossover junction endodeoxyribonuclease RuvC -
  EL136_RS04480 (NCTC6180_00922) - 925338..925679 (-) 342 WP_003052428.1 hypothetical protein -
  EL136_RS04485 (NCTC6180_00923) - 925857..926654 (-) 798 WP_154803897.1 PD-(D/E)XK nuclease-like domain-containing protein -
  EL136_RS04490 (NCTC6180_00924) - 926651..927571 (-) 921 WP_154803898.1 recombinase RecT -
  EL136_RS04495 (NCTC6180_00925) - 927627..927833 (-) 207 WP_154803899.1 hypothetical protein -
  EL136_RS04500 (NCTC6180_00926) - 927870..928103 (-) 234 WP_154803900.1 hypothetical protein -
  EL136_RS04505 (NCTC6180_00927) - 928084..928467 (-) 384 WP_154803901.1 DnaD domain-containing protein -
  EL136_RS04510 - 928599..928844 (-) 246 WP_012678836.1 helix-turn-helix domain-containing protein -
  EL136_RS10985 (NCTC6180_00929) - 929048..929188 (-) 141 WP_172954514.1 hypothetical protein -
  EL136_RS04515 (NCTC6180_00930) - 929190..929480 (-) 291 WP_154803902.1 MerR family transcriptional regulator -
  EL136_RS04520 (NCTC6180_00931) - 929669..929884 (+) 216 WP_027970312.1 hypothetical protein -
  EL136_RS04525 (NCTC6180_00933) - 930039..930764 (-) 726 WP_154803903.1 phage antirepressor KilAC domain-containing protein -
  EL136_RS04530 (NCTC6180_00934) - 930832..931023 (-) 192 WP_043983624.1 helix-turn-helix transcriptional regulator -
  EL136_RS04535 (NCTC6180_00935) - 931117..931809 (+) 693 WP_136059166.1 DUF4145 domain-containing protein -
  EL136_RS04540 (NCTC6180_00936) - 931785..931994 (-) 210 WP_136059167.1 hypothetical protein -
  EL136_RS04545 (NCTC6180_00937) - 932028..932186 (-) 159 WP_154803904.1 hypothetical protein -
  EL136_RS04550 (NCTC6180_00938) - 932348..933142 (+) 795 WP_154803905.1 XRE family transcriptional regulator -
  EL136_RS04555 (NCTC6180_00939) - 933357..934031 (+) 675 WP_154803906.1 NYN domain-containing protein -
  EL136_RS04560 (NCTC6180_00940) - 934152..935240 (+) 1089 WP_043052993.1 site-specific integrase -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7231.20 Da        Isoelectric Point: 4.3297

>NTDB_id=1121271 EL136_RS04295 WP_037578450.1 896267..896455(-) (prx) [Streptococcus equi subsp. zooepidemicus strain NCTC6180]
MLTYDEFKQAIDDGYIAGDTVTIVRKNGQIFDYVLPGEPVRPWETLTEERVDEVLTKLHYIK

Nucleotide


Download         Length: 189 bp        

>NTDB_id=1121271 EL136_RS04295 WP_037578450.1 896267..896455(-) (prx) [Streptococcus equi subsp. zooepidemicus strain NCTC6180]
ATGCTAACATACGACGAGTTTAAGCAAGCTATTGACGACGGTTATATCGCAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGCCTGTGAGACCGTGGGAGACTCTGACTGAAGAAAGAGTAGACGAGG
TGCTGACGAAATTACACTATATCAAGTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

75.806

100

0.758

  prx Streptococcus pyogenes MGAS315

75.862

93.548

0.71

  prx Streptococcus pyogenes MGAS8232

74.138

93.548

0.694

  prx Streptococcus pyogenes MGAS315

72.414

93.548

0.677

  prx Streptococcus pyogenes MGAS315

69.492

95.161

0.661

  prx Streptococcus pyogenes MGAS315

90.476

67.742

0.613

  prx Streptococcus pyogenes MGAS315

78.049

66.129

0.516


Multiple sequence alignment