Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   EL139_RS04315 Genome accession   NZ_LR134316
Coordinates   809981..810163 (+) Length   60 a.a.
NCBI ID   WP_111717696.1    Uniprot ID   A0A9X8T223
Organism   Streptococcus dysgalactiae subsp. equisimilis strain NCTC6181     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 764808..824792 809981..810163 within 0


Gene organization within MGE regions


Location: 764808..824792
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL139_RS04040 (NCTC6181_00823) - 764808..765881 (-) 1074 WP_111717733.1 site-specific integrase -
  EL139_RS04045 (NCTC6181_00824) - 766142..767734 (-) 1593 WP_111717732.1 SIR2 family protein -
  EL139_RS04050 (NCTC6181_00825) - 767752..768138 (-) 387 WP_111705753.1 ImmA/IrrE family metallo-endopeptidase -
  EL139_RS04055 (NCTC6181_00826) - 768142..768489 (-) 348 WP_111717731.1 helix-turn-helix transcriptional regulator -
  EL139_RS04060 (NCTC6181_00827) - 769247..769438 (+) 192 WP_001283052.1 hypothetical protein -
  EL139_RS04065 (NCTC6181_00828) - 769449..770249 (+) 801 WP_111717730.1 phage antirepressor KilAC domain-containing protein -
  EL139_RS04070 (NCTC6181_00829) - 770310..770585 (+) 276 WP_003052448.1 hypothetical protein -
  EL139_RS04075 (NCTC6181_00830) - 770582..770752 (+) 171 WP_111717729.1 hypothetical protein -
  EL139_RS04080 (NCTC6181_00831) - 770745..770951 (+) 207 WP_050317062.1 hypothetical protein -
  EL139_RS04085 (NCTC6181_00832) - 770948..771331 (+) 384 WP_111717728.1 hypothetical protein -
  EL139_RS04090 (NCTC6181_00834) - 771477..771680 (+) 204 WP_002983407.1 hypothetical protein -
  EL139_RS04095 (NCTC6181_00835) - 771768..772067 (+) 300 WP_043024982.1 hypothetical protein -
  EL139_RS04100 (NCTC6181_00836) - 772067..773224 (+) 1158 WP_002983409.1 DUF2800 domain-containing protein -
  EL139_RS04105 (NCTC6181_00837) - 773238..773801 (+) 564 WP_002983410.1 DUF2815 family protein -
  EL139_RS04110 (NCTC6181_00838) - 773844..775766 (+) 1923 WP_111717727.1 DNA polymerase -
  EL139_RS04115 (NCTC6181_00839) - 775771..778155 (+) 2385 WP_111717726.1 phage/plasmid primase, P4 family -
  EL139_RS04120 (NCTC6181_00840) - 778522..778797 (+) 276 WP_111717725.1 VRR-NUC domain-containing protein -
  EL139_RS04125 (NCTC6181_00841) - 778794..780116 (+) 1323 WP_002983414.1 SNF2-related protein -
  EL139_RS11150 (NCTC6181_00842) - 780117..780284 (+) 168 WP_164714884.1 hypothetical protein -
  EL139_RS04130 (NCTC6181_00843) - 780281..780547 (+) 267 WP_111717724.1 hypothetical protein -
  EL139_RS04135 (NCTC6181_00844) - 780551..780742 (+) 192 WP_111717723.1 hypothetical protein -
  EL139_RS04140 (NCTC6181_00845) - 780739..781155 (+) 417 WP_002988747.1 DUF722 domain-containing protein -
  EL139_RS04145 (NCTC6181_00846) terS 781275..781970 (+) 696 WP_050318691.1 phage terminase small subunit -
  EL139_RS04150 (NCTC6181_00847) - 781963..783258 (+) 1296 WP_164714885.1 PBSX family phage terminase large subunit -
  EL139_RS04155 (NCTC6181_00848) - 783272..784774 (+) 1503 WP_111717722.1 phage portal protein -
  EL139_RS04160 (NCTC6181_00849) - 784779..786272 (+) 1494 WP_111717721.1 phage minor capsid protein -
  EL139_RS04165 (NCTC6181_00850) - 786272..786499 (+) 228 WP_111717720.1 hypothetical protein -
  EL139_RS04170 (NCTC6181_00851) - 786655..787599 (+) 945 WP_111715146.1 IS30 family transposase -
  EL139_RS04175 (NCTC6181_00852) - 787637..787903 (+) 267 WP_111717719.1 hypothetical protein -
  EL139_RS04180 (NCTC6181_00853) - 788033..788647 (+) 615 WP_111717718.1 hypothetical protein -
  EL139_RS04185 (NCTC6181_00854) - 788651..789487 (+) 837 WP_111717717.1 N4-gp56 family major capsid protein -
  EL139_RS04190 (NCTC6181_00855) - 789497..789766 (+) 270 WP_111717716.1 HeH/LEM domain-containing protein -
  EL139_RS04195 (NCTC6181_00856) - 789792..790193 (+) 402 WP_164714920.1 hypothetical protein -
  EL139_RS04200 (NCTC6181_00857) - 790183..790515 (+) 333 WP_111717714.1 minor capsid protein -
  EL139_RS04205 (NCTC6181_00858) - 790515..790871 (+) 357 WP_111717713.1 minor capsid protein -
  EL139_RS04210 (NCTC6181_00859) - 790868..791266 (+) 399 WP_111717712.1 minor capsid protein -
  EL139_RS04215 (NCTC6181_00860) - 791266..791754 (+) 489 WP_111717711.1 phage tail protein -
  EL139_RS04220 (NCTC6181_00861) - 791797..792231 (+) 435 WP_111717710.1 hypothetical protein -
  EL139_RS04225 (NCTC6181_00862) - 792235..792816 (+) 582 WP_111717709.1 bacteriophage Gp15 family protein -
  EL139_RS04230 (NCTC6181_00863) - 792806..796066 (+) 3261 WP_111717708.1 tape measure protein -
  EL139_RS04235 (NCTC6181_00864) - 796063..796779 (+) 717 WP_111717707.1 distal tail protein Dit -
  EL139_RS04240 (NCTC6181_00865) - 796776..798923 (+) 2148 WP_111717706.1 phage tail spike protein -
  EL139_RS04245 (NCTC6181_00866) - 798920..800317 (+) 1398 WP_111717705.1 hypothetical protein -
  EL139_RS04250 (NCTC6181_00867) - 800320..800943 (+) 624 WP_111717704.1 hypothetical protein -
  EL139_RS04255 (NCTC6181_00868) - 800954..802840 (+) 1887 WP_111717703.1 gp58-like family protein -
  EL139_RS04260 (NCTC6181_00869) - 802852..803280 (+) 429 WP_111717702.1 DUF1617 family protein -
  EL139_RS04265 (NCTC6181_00870) - 803283..803903 (+) 621 WP_111717701.1 DUF1366 domain-containing protein -
  EL139_RS04270 (NCTC6181_00871) - 803914..804213 (+) 300 WP_002988799.1 hypothetical protein -
  EL139_RS04275 (NCTC6181_00872) - 804210..804395 (+) 186 WP_011888776.1 holin -
  EL139_RS04280 (NCTC6181_00874) - 804509..805726 (+) 1218 WP_111717700.1 peptidoglycan amidohydrolase family protein -
  EL139_RS04285 (NCTC6181_00875) - 806032..807003 (+) 972 WP_011888780.1 Abi family protein -
  EL139_RS04290 (NCTC6181_00876) - 807126..808259 (+) 1134 WP_111714946.1 ISAs1 family transposase -
  EL139_RS04295 (NCTC6181_00878) - 808513..808713 (+) 201 WP_011888781.1 CsbD family protein -
  EL139_RS04300 (NCTC6181_00879) - 808811..808996 (-) 186 WP_111717699.1 XRE family transcriptional regulator -
  EL139_RS04305 (NCTC6181_00880) - 808998..809471 (-) 474 WP_111717698.1 hypothetical protein -
  EL139_RS04310 (NCTC6181_00881) - 809503..809811 (-) 309 WP_111717697.1 hypothetical protein -
  EL139_RS04315 (NCTC6181_00882) prx 809981..810163 (+) 183 WP_111717696.1 Paratox Regulator
  EL139_RS04320 (NCTC6181_00883) - 810394..811014 (-) 621 WP_111717695.1 alpha/beta hydrolase -
  EL139_RS04325 (NCTC6181_00884) - 811027..811635 (-) 609 WP_111717694.1 flavin reductase family protein -
  EL139_RS04330 (NCTC6181_00885) - 811811..812272 (-) 462 WP_231871986.1 VOC family protein -
  EL139_RS04335 (NCTC6181_00886) - 812405..814462 (-) 2058 WP_111717693.1 sodium:proton antiporter -
  EL139_RS04340 (NCTC6181_00887) - 814474..814734 (-) 261 WP_111717692.1 hypothetical protein -
  EL139_RS04345 (NCTC6181_00888) - 814722..815306 (-) 585 WP_111717691.1 GNAT family N-acetyltransferase -
  EL139_RS04350 (NCTC6181_00889) - 815608..815886 (-) 279 WP_111717690.1 GNAT family N-acetyltransferase -
  EL139_RS04355 (NCTC6181_00890) - 816002..816403 (-) 402 WP_126442244.1 GNAT family N-acetyltransferase -
  EL139_RS04360 (NCTC6181_00891) - 816397..817338 (-) 942 WP_111717688.1 2-keto-3-deoxygluconate permease -
  EL139_RS04365 (NCTC6181_00892) - 817387..817842 (-) 456 WP_111717687.1 MarR family transcriptional regulator -
  EL139_RS04370 (NCTC6181_00893) - 817974..818948 (-) 975 WP_111717686.1 amidohydrolase family protein -
  EL139_RS04375 - 819359..819562 (+) 204 WP_003053018.1 cold-shock protein -
  EL139_RS04380 (NCTC6181_00895) - 819758..820219 (+) 462 WP_003054759.1 CtsR family transcriptional regulator -
  EL139_RS04385 (NCTC6181_00896) clpC 820219..822663 (+) 2445 WP_111717685.1 ATP-dependent Clp protease ATP-binding subunit Regulator
  EL139_RS04390 (NCTC6181_00897) groES 822841..823131 (+) 291 WP_111717684.1 co-chaperone GroES -
  EL139_RS04395 (NCTC6181_00898) groL 823167..824792 (+) 1626 WP_012767614.1 chaperonin GroEL -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6918.75 Da        Isoelectric Point: 3.9944

>NTDB_id=1121219 EL139_RS04315 WP_111717696.1 809981..810163(+) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC6181]
MLTYDEFKQAIDDGYIAGDTVTIVRKNGQIFDYVLPGEPVRQWEVVTEEVVGEVTRELER

Nucleotide


Download         Length: 183 bp        

>NTDB_id=1121219 EL139_RS04315 WP_111717696.1 809981..810163(+) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC6181]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGATGACGGATATATCGCAGGAGACACAGTCACGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGCCTGTGAGACAGTGGGAAGTAGTGACGGAGGAAGTGGTGGGAGAAG
TGACGAGAGAGTTAGAACGCTAG

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS8232

76.667

100

0.767

  prx Streptococcus pyogenes MGAS315

71.667

100

0.717

  prx Streptococcus pyogenes MGAS315

71.667

100

0.717

  prx Streptococcus pyogenes MGAS315

90.244

68.333

0.617

  prx Streptococcus pyogenes MGAS315

85.714

70

0.6

  prx Streptococcus pyogenes MGAS315

78.049

68.333

0.533


Multiple sequence alignment