Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EL070_RS02590 | Genome accession | NZ_LR134284 |
| Coordinates | 479110..479289 (+) | Length | 59 a.a. |
| NCBI ID | WP_002983481.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8232 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 434417..479289 | 479110..479289 | within | 0 |
Gene organization within MGE regions
Location: 434417..479289
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL070_RS02305 (NCTC8232_00453) | - | 434417..435496 (-) | 1080 | WP_002983389.1 | site-specific integrase | - |
| EL070_RS02310 (NCTC8232_00454) | - | 435617..436474 (-) | 858 | WP_111680774.1 | DNA adenine methylase | - |
| EL070_RS02315 (NCTC8232_00455) | - | 436531..438252 (-) | 1722 | WP_002983395.1 | ATP-dependent nuclease | - |
| EL070_RS02320 (NCTC8232_00456) | - | 438377..438763 (-) | 387 | WP_002983397.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EL070_RS02325 (NCTC8232_00457) | - | 438767..439114 (-) | 348 | WP_002983399.1 | helix-turn-helix domain-containing protein | - |
| EL070_RS02330 (NCTC8232_00458) | - | 439405..439614 (+) | 210 | WP_002983400.1 | helix-turn-helix domain-containing protein | - |
| EL070_RS02335 (NCTC8232_00459) | - | 439673..439948 (+) | 276 | WP_032467257.1 | DNA-binding phage protein | - |
| EL070_RS02340 (NCTC8232_00460) | - | 439945..440115 (+) | 171 | WP_002983403.1 | hypothetical protein | - |
| EL070_RS02345 (NCTC8232_00461) | - | 440108..440314 (+) | 207 | WP_002983404.1 | hypothetical protein | - |
| EL070_RS02350 (NCTC8232_00462) | - | 440311..440694 (+) | 384 | WP_111705752.1 | hypothetical protein | - |
| EL070_RS10000 (NCTC8232_00463) | - | 440691..440843 (+) | 153 | WP_002983406.1 | hypothetical protein | - |
| EL070_RS02355 (NCTC8232_00464) | - | 440840..441043 (+) | 204 | WP_002983407.1 | hypothetical protein | - |
| EL070_RS02360 (NCTC8232_00465) | - | 441131..441430 (+) | 300 | WP_002983408.1 | hypothetical protein | - |
| EL070_RS02365 (NCTC8232_00466) | - | 441430..442587 (+) | 1158 | WP_002983409.1 | DUF2800 domain-containing protein | - |
| EL070_RS02370 (NCTC8232_00467) | - | 442601..443164 (+) | 564 | WP_002983410.1 | DUF2815 family protein | - |
| EL070_RS02375 (NCTC8232_00468) | - | 443207..445138 (+) | 1932 | WP_002983411.1 | DNA polymerase | - |
| EL070_RS02380 (NCTC8232_00469) | - | 445143..447527 (+) | 2385 | WP_002983412.1 | phage/plasmid primase, P4 family | - |
| EL070_RS02385 (NCTC8232_00470) | - | 447894..448169 (+) | 276 | WP_002983413.1 | VRR-NUC domain-containing protein | - |
| EL070_RS02390 (NCTC8232_00471) | - | 448166..449488 (+) | 1323 | WP_002983414.1 | SNF2-related protein | - |
| EL070_RS10005 (NCTC8232_00472) | - | 449489..449650 (+) | 162 | WP_002983415.1 | hypothetical protein | - |
| EL070_RS02395 (NCTC8232_00473) | - | 449653..449919 (+) | 267 | WP_111705751.1 | hypothetical protein | - |
| EL070_RS02400 (NCTC8232_00474) | - | 449921..450556 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| EL070_RS02410 (NCTC8232_00475) | - | 450830..451264 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EL070_RS02420 (NCTC8232_00476) | - | 451842..452756 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| EL070_RS10010 | - | 452846..453079 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| EL070_RS02430 (NCTC8232_00478) | - | 453374..453751 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| EL070_RS02435 (NCTC8232_00479) | - | 453803..453988 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| EL070_RS02440 (NCTC8232_00480) | - | 454087..454518 (+) | 432 | WP_020833531.1 | terminase small subunit | - |
| EL070_RS02445 (NCTC8232_00481) | - | 454496..455803 (+) | 1308 | WP_111677299.1 | PBSX family phage terminase large subunit | - |
| EL070_RS02450 (NCTC8232_00482) | - | 455815..457317 (+) | 1503 | WP_126405114.1 | phage portal protein | - |
| EL070_RS02455 (NCTC8232_00483) | - | 457298..458923 (+) | 1626 | WP_126405115.1 | phage minor head protein | - |
| EL070_RS02460 (NCTC8232_00484) | - | 458914..459093 (+) | 180 | WP_010922213.1 | hypothetical protein | - |
| EL070_RS02465 (NCTC8232_00485) | - | 459153..459422 (+) | 270 | WP_002984375.1 | hypothetical protein | - |
| EL070_RS02470 (NCTC8232_00486) | - | 459518..459697 (+) | 180 | WP_011017861.1 | hypothetical protein | - |
| EL070_RS02475 (NCTC8232_00487) | - | 459812..460060 (+) | 249 | WP_002984380.1 | hypothetical protein | - |
| EL070_RS02480 (NCTC8232_00488) | - | 460062..460805 (+) | 744 | WP_002984382.1 | phage repressor protein/antirepressor Ant | - |
| EL070_RS02485 (NCTC8232_00489) | - | 460917..461450 (+) | 534 | WP_111705645.1 | DUF4355 domain-containing protein | - |
| EL070_RS02490 (NCTC8232_00490) | - | 461460..461840 (+) | 381 | WP_002984386.1 | phage protein | - |
| EL070_RS02495 | - | 461840..462935 (+) | 1096 | Protein_428 | major capsid protein | - |
| EL070_RS02500 (NCTC8232_00493) | - | 462923..463165 (+) | 243 | WP_002984390.1 | HeH/LEM domain-containing protein | - |
| EL070_RS10145 | - | 463179..463533 (+) | 355 | Protein_430 | phage head-tail connector protein | - |
| EL070_RS10410 | - | 463530..463849 (+) | 320 | Protein_431 | hypothetical protein | - |
| EL070_RS02515 | - | 463828..464183 (+) | 356 | Protein_432 | HK97-gp10 family putative phage morphogenesis protein | - |
| EL070_RS02520 (NCTC8232_00497) | - | 464180..464569 (+) | 390 | WP_002984401.1 | hypothetical protein | - |
| EL070_RS02525 (NCTC8232_00498) | - | 464579..465232 (+) | 654 | WP_415245011.1 | phage major tail protein, TP901-1 family | - |
| EL070_RS02530 (NCTC8232_00499) | - | 465278..465637 (+) | 360 | WP_002984405.1 | tail assembly chaperone | - |
| EL070_RS02535 | - | 465712..466044 (+) | 333 | WP_232013151.1 | hypothetical protein | - |
| EL070_RS10415 | - | 466022..469273 (+) | 3252 | Protein_437 | tape measure protein | - |
| EL070_RS02545 (NCTC8232_00504) | - | 469305..470084 (+) | 780 | WP_002984411.1 | distal tail protein Dit | - |
| EL070_RS02550 (NCTC8232_00505) | - | 470081..472117 (+) | 2037 | WP_111705643.1 | phage tail spike protein | - |
| EL070_RS02555 (NCTC8232_00506) | - | 472114..473121 (+) | 1008 | WP_111705642.1 | hyaluronoglucosaminidase | - |
| EL070_RS02560 (NCTC8232_00507) | - | 473134..475152 (+) | 2019 | WP_126405116.1 | gp58-like family protein | - |
| EL070_RS02565 (NCTC8232_00508) | - | 475164..475595 (+) | 432 | WP_111705749.1 | DUF1617 family protein | - |
| EL070_RS02570 (NCTC8232_00509) | - | 475598..476212 (+) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| EL070_RS02575 (NCTC8232_00510) | - | 476223..476678 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| EL070_RS02580 (NCTC8232_00512) | - | 476790..478004 (+) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| EL070_RS02585 (NCTC8232_00513) | - | 478249..479043 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| EL070_RS02590 (NCTC8232_00514) | prx | 479110..479289 (+) | 180 | WP_002983481.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.1813
>NTDB_id=1120097 EL070_RS02590 WP_002983481.1 479110..479289(+) (prx) [Streptococcus pyogenes strain NCTC8232]
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1120097 EL070_RS02590 WP_002983481.1 479110..479289(+) (prx) [Streptococcus pyogenes strain NCTC8232]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
100 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
71.186 |
0.542 |