Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EL078_RS02775 | Genome accession | NZ_LR134282 |
| Coordinates | 510698..510883 (+) | Length | 61 a.a. |
| NCBI ID | WP_126437671.1 | Uniprot ID | - |
| Organism | Streptococcus equinus strain NCTC8140 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 498712..513956 | 510698..510883 | within | 0 |
Gene organization within MGE regions
Location: 498712..513956
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL078_RS02675 (NCTC8140_00537) | - | 498712..499875 (-) | 1164 | WP_126437657.1 | tyrosine-type recombinase/integrase | - |
| EL078_RS02680 (NCTC8140_00538) | - | 500189..501154 (-) | 966 | WP_126437658.1 | DUF3644 domain-containing protein | - |
| EL078_RS02685 (NCTC8140_00539) | - | 501190..501762 (-) | 573 | WP_074601417.1 | helix-turn-helix domain-containing protein | - |
| EL078_RS02690 (NCTC8140_00540) | - | 501917..502102 (+) | 186 | WP_074601419.1 | hypothetical protein | - |
| EL078_RS02695 (NCTC8140_00541) | - | 502361..502663 (+) | 303 | WP_126437659.1 | hypothetical protein | - |
| EL078_RS02700 (NCTC8140_00542) | - | 502680..502874 (+) | 195 | WP_126437660.1 | hypothetical protein | - |
| EL078_RS02705 (NCTC8140_00543) | - | 502890..503123 (+) | 234 | WP_126437661.1 | hypothetical protein | - |
| EL078_RS02710 (NCTC8140_00544) | - | 503125..503391 (+) | 267 | WP_039696601.1 | hypothetical protein | - |
| EL078_RS02715 (NCTC8140_00545) | - | 503405..504256 (+) | 852 | WP_126437662.1 | DnaD domain protein | - |
| EL078_RS02720 (NCTC8140_00546) | - | 504276..505124 (+) | 849 | WP_411756605.1 | ATP-binding protein | - |
| EL078_RS02725 (NCTC8140_00547) | - | 505241..505816 (+) | 576 | WP_126437664.1 | hypothetical protein | - |
| EL078_RS02730 (NCTC8140_00548) | - | 505809..506192 (+) | 384 | WP_126437665.1 | hypothetical protein | - |
| EL078_RS02735 (NCTC8140_00549) | - | 506329..506733 (+) | 405 | WP_039696605.1 | hypothetical protein | - |
| EL078_RS02740 (NCTC8140_00550) | - | 506812..507012 (+) | 201 | WP_126437666.1 | CPCC family cysteine-rich protein | - |
| EL078_RS02745 (NCTC8140_00551) | - | 507108..507521 (+) | 414 | WP_164554303.1 | DUF1492 domain-containing protein | - |
| EL078_RS02750 (NCTC8140_00552) | - | 507735..507938 (+) | 204 | WP_126437668.1 | CPCC family cysteine-rich protein | - |
| EL078_RS02760 (NCTC8140_00553) | - | 508487..508699 (+) | 213 | WP_052698786.1 | hypothetical protein | - |
| EL078_RS02765 (NCTC8140_00554) | - | 509707..510222 (+) | 516 | WP_126437669.1 | hypothetical protein | - |
| EL078_RS02770 (NCTC8140_00555) | - | 510431..510622 (+) | 192 | WP_126437670.1 | helix-turn-helix domain-containing protein | - |
| EL078_RS02775 (NCTC8140_00556) | prx | 510698..510883 (+) | 186 | WP_126437671.1 | Paratox | Regulator |
| EL078_RS02780 (NCTC8140_00557) | ftsA | 511243..512610 (+) | 1368 | WP_021141859.1 | cell division protein FtsA | - |
| EL078_RS02785 (NCTC8140_00558) | ftsZ | 512631..513956 (+) | 1326 | WP_024344231.1 | cell division protein FtsZ | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 7234.29 Da Isoelectric Point: 4.2558
>NTDB_id=1119968 EL078_RS02775 WP_126437671.1 510698..510883(+) (prx) [Streptococcus equinus strain NCTC8140]
MLYYDELKEAIDRGFIKGDTVQIVRKNGIVFDYVLPNEPIKPYEVVTTEKVADVWEELKEW
MLYYDELKEAIDRGFIKGDTVQIVRKNGIVFDYVLPNEPIKPYEVVTTEKVADVWEELKEW
Nucleotide
Download Length: 186 bp
>NTDB_id=1119968 EL078_RS02775 WP_126437671.1 510698..510883(+) (prx) [Streptococcus equinus strain NCTC8140]
ATGCTATATTATGATGAACTAAAAGAGGCAATCGATAGAGGCTTTATAAAAGGTGATACTGTTCAAATTGTGAGAAAGAA
TGGGATAGTATTTGATTATGTTCTCCCTAATGAGCCTATAAAACCTTACGAGGTGGTTACCACTGAAAAGGTAGCAGACG
TTTGGGAAGAGCTAAAAGAATGGTAG
ATGCTATATTATGATGAACTAAAAGAGGCAATCGATAGAGGCTTTATAAAAGGTGATACTGTTCAAATTGTGAGAAAGAA
TGGGATAGTATTTGATTATGTTCTCCCTAATGAGCCTATAAAACCTTACGAGGTGGTTACCACTGAAAAGGTAGCAGACG
TTTGGGAAGAGCTAAAAGAATGGTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
67.797 |
96.721 |
0.656 |
| prx | Streptococcus pyogenes MGAS8232 |
65.517 |
95.082 |
0.623 |
| prx | Streptococcus pyogenes MGAS315 |
63.793 |
95.082 |
0.607 |
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
95.082 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
69.048 |
68.852 |
0.475 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |
| prx | Streptococcus pyogenes MGAS315 |
68.293 |
67.213 |
0.459 |