Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EL071_RS09630 | Genome accession | NZ_LR134265 |
| Coordinates | 1877719..1877898 (-) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain NCTC8184 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1875690..1915658 | 1877719..1877898 | within | 0 |
| IScluster/Tn | 1875690..1877035 | 1877719..1877898 | flank | 684 |
Gene organization within MGE regions
Location: 1875690..1915658
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL071_RS09625 (NCTC8184_01913) | - | 1877116..1877313 (-) | 198 | WP_001290370.1 | hypothetical protein | - |
| EL071_RS09630 (NCTC8184_01914) | prx | 1877719..1877898 (-) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| EL071_RS12135 (NCTC8184_01915) | - | 1878057..1878182 (+) | 126 | WP_017646884.1 | hypothetical protein | - |
| EL071_RS09635 (NCTC8184_01916) | - | 1878318..1878488 (+) | 171 | WP_000356856.1 | hypothetical protein | - |
| EL071_RS09640 (NCTC8184_01917) | - | 1878529..1878729 (-) | 201 | WP_000076712.1 | CsbD family protein | - |
| EL071_RS09645 (NCTC8184_01918) | - | 1878857..1879372 (-) | 516 | WP_000837684.1 | hypothetical protein | - |
| EL071_RS12170 | - | 1879665..1880468 (-) | 804 | Protein_1803 | GH25 family lysozyme | - |
| EL071_RS12175 | - | 1881027..1881764 (-) | 738 | Protein_1804 | phage tail protein | - |
| EL071_RS09655 (NCTC8184_01920) | - | 1881777..1882619 (-) | 843 | WP_115356916.1 | phage tail domain-containing protein | - |
| EL071_RS09660 (NCTC8184_01921) | - | 1882632..1886858 (-) | 4227 | WP_000929199.1 | tape measure protein | - |
| EL071_RS09665 (NCTC8184_01922) | - | 1886887..1887117 (-) | 231 | WP_000398752.1 | hypothetical protein | - |
| EL071_RS09670 (NCTC8184_01923) | - | 1887192..1887647 (-) | 456 | WP_000424190.1 | tail assembly chaperone | - |
| EL071_RS09675 (NCTC8184_01924) | - | 1887704..1888330 (-) | 627 | WP_115356918.1 | phage major tail protein, TP901-1 family | - |
| EL071_RS09680 (NCTC8184_01925) | - | 1888342..1888701 (-) | 360 | WP_115356919.1 | hypothetical protein | - |
| EL071_RS09685 (NCTC8184_01926) | - | 1888705..1889049 (-) | 345 | WP_000060407.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EL071_RS09690 (NCTC8184_01927) | - | 1889046..1889324 (-) | 279 | WP_000639436.1 | hypothetical protein | - |
| EL071_RS09695 (NCTC8184_01928) | - | 1889335..1889691 (-) | 357 | WP_000356704.1 | phage head-tail connector protein | - |
| EL071_RS11925 (NCTC8184_01929) | - | 1889697..1890593 (-) | 897 | WP_000818573.1 | hypothetical protein | - |
| EL071_RS09705 (NCTC8184_01930) | - | 1890612..1891181 (-) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| EL071_RS09710 (NCTC8184_01931) | - | 1891317..1891526 (-) | 210 | WP_115356920.1 | hypothetical protein | - |
| EL071_RS12180 | - | 1891531..1891719 (-) | 189 | WP_025194292.1 | hypothetical protein | - |
| EL071_RS09720 (NCTC8184_01933) | - | 1891747..1893195 (-) | 1449 | WP_032457629.1 | phage head morphogenesis protein | - |
| EL071_RS09725 (NCTC8184_01934) | - | 1893155..1894684 (-) | 1530 | WP_000462947.1 | phage portal protein | - |
| EL071_RS09730 (NCTC8184_01935) | - | 1894699..1895979 (-) | 1281 | WP_000208744.1 | PBSX family phage terminase large subunit | - |
| EL071_RS09735 (NCTC8184_01936) | - | 1895969..1896400 (-) | 432 | WP_038406064.1 | terminase small subunit | - |
| EL071_RS09740 (NCTC8184_01937) | - | 1896454..1897206 (-) | 753 | WP_001075092.1 | TIR domain-containing protein | - |
| EL071_RS09745 (NCTC8184_01938) | - | 1897381..1897794 (-) | 414 | WP_000041037.1 | transcriptional regulator | - |
| EL071_RS09750 (NCTC8184_01939) | - | 1897871..1898104 (-) | 234 | WP_001005354.1 | hypothetical protein | - |
| EL071_RS09755 (NCTC8184_01940) | - | 1898101..1898337 (-) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| EL071_RS09760 (NCTC8184_01941) | - | 1898334..1898549 (-) | 216 | WP_000687319.1 | hypothetical protein | - |
| EL071_RS09765 (NCTC8184_01942) | - | 1898546..1898941 (-) | 396 | WP_000569002.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EL071_RS09770 (NCTC8184_01943) | - | 1898934..1899152 (-) | 219 | WP_000388746.1 | hypothetical protein | - |
| EL071_RS09775 (NCTC8184_01944) | - | 1899452..1901731 (-) | 2280 | WP_115356921.1 | AAA family ATPase | - |
| EL071_RS09780 (NCTC8184_01945) | - | 1901802..1902053 (+) | 252 | WP_001114109.1 | hypothetical protein | - |
| EL071_RS09785 (NCTC8184_01946) | - | 1902046..1902243 (-) | 198 | WP_000427885.1 | hypothetical protein | - |
| EL071_RS09790 (NCTC8184_01947) | - | 1902252..1903835 (-) | 1584 | WP_032457631.1 | DEAD/DEAH box helicase | - |
| EL071_RS09795 (NCTC8184_01948) | - | 1903841..1904449 (-) | 609 | WP_001876771.1 | hypothetical protein | - |
| EL071_RS09800 (NCTC8184_01949) | - | 1904449..1905054 (-) | 606 | WP_000141562.1 | hypothetical protein | - |
| EL071_RS09805 (NCTC8184_01950) | - | 1905075..1905809 (-) | 735 | WP_001293486.1 | hypothetical protein | - |
| EL071_RS09810 (NCTC8184_01951) | - | 1905811..1906233 (-) | 423 | WP_000361801.1 | hypothetical protein | - |
| EL071_RS09815 (NCTC8184_01952) | - | 1906273..1907367 (-) | 1095 | WP_115356922.1 | ATP-binding protein | - |
| EL071_RS09820 (NCTC8184_01953) | - | 1907382..1908701 (-) | 1320 | WP_129544890.1 | AAA family ATPase | - |
| EL071_RS09825 (NCTC8184_01954) | - | 1908685..1908915 (-) | 231 | WP_000573548.1 | hypothetical protein | - |
| EL071_RS09830 (NCTC8184_01955) | - | 1908908..1909135 (-) | 228 | WP_000910901.1 | hypothetical protein | - |
| EL071_RS11930 (NCTC8184_01956) | - | 1909129..1909278 (-) | 150 | WP_000732608.1 | hypothetical protein | - |
| EL071_RS09835 (NCTC8184_01957) | - | 1909283..1909594 (-) | 312 | WP_001123483.1 | hypothetical protein | - |
| EL071_RS09840 (NCTC8184_01958) | - | 1909674..1909865 (-) | 192 | WP_001112862.1 | hypothetical protein | - |
| EL071_RS09845 (NCTC8184_01959) | - | 1909916..1910704 (+) | 789 | WP_000092751.1 | hypothetical protein | - |
| EL071_RS09850 (NCTC8184_01960) | - | 1910655..1910900 (-) | 246 | WP_000739595.1 | hypothetical protein | - |
| EL071_RS09855 (NCTC8184_01961) | - | 1911197..1911544 (+) | 348 | WP_000493080.1 | helix-turn-helix transcriptional regulator | - |
| EL071_RS09860 (NCTC8184_01962) | - | 1911548..1911934 (+) | 387 | WP_000151183.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EL071_RS09865 (NCTC8184_01963) | - | 1911952..1912533 (+) | 582 | WP_129544891.1 | hypothetical protein | - |
| EL071_RS09870 (NCTC8184_01964) | - | 1912617..1913759 (+) | 1143 | WP_000269474.1 | site-specific integrase | - |
| EL071_RS09875 (NCTC8184_01965) | - | 1913847..1914122 (-) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| EL071_RS09880 (NCTC8184_01966) | - | 1914225..1914826 (-) | 602 | Protein_1851 | YpmS family protein | - |
| EL071_RS09885 (NCTC8184_01967) | - | 1914801..1915640 (-) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=1119525 EL071_RS09630 WP_000965651.1 1877719..1877898(-) (prx) [Streptococcus agalactiae strain NCTC8184]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1119525 EL071_RS09630 WP_000965651.1 1877719..1877898(-) (prx) [Streptococcus agalactiae strain NCTC8184]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |