Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EL071_RS09335 | Genome accession | NZ_LR134265 |
| Coordinates | 1824097..1824285 (-) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain NCTC8184 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1824741..1833513 | 1824097..1824285 | flank | 456 |
| IS/Tn | 1824741..1825352 | 1824097..1824285 | flank | 456 |
Gene organization within MGE regions
Location: 1824097..1833513
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL071_RS09335 | prx | 1824097..1824285 (-) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| EL071_RS09340 (NCTC8184_01857) | - | 1824327..1824527 (-) | 201 | WP_000076708.1 | CsbD family protein | - |
| EL071_RS09345 (NCTC8184_01858) | - | 1824705..1825352 (+) | 648 | Protein_1748 | IS3 family transposase | - |
| EL071_RS09350 (NCTC8184_01859) | - | 1825404..1826723 (-) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| EL071_RS09355 (NCTC8184_01860) | - | 1826720..1827373 (-) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| EL071_RS09360 (NCTC8184_01861) | - | 1827470..1828845 (-) | 1376 | Protein_1751 | FtsX-like permease family protein | - |
| EL071_RS09365 (NCTC8184_01862) | - | 1828845..1829501 (-) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| EL071_RS09370 (NCTC8184_01863) | - | 1829511..1830788 (-) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| EL071_RS09375 | - | 1831530..1831691 (+) | 162 | WP_000508795.1 | NINE protein | - |
| EL071_RS12080 | - | 1831864..1833226 (-) | 1363 | Protein_1755 | IS3 family transposase | - |
| EL071_RS09400 (NCTC8184_01867) | - | 1833247..1833513 (+) | 267 | WP_001872365.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=1119523 EL071_RS09335 WP_000027835.1 1824097..1824285(-) (prx) [Streptococcus agalactiae strain NCTC8184]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=1119523 EL071_RS09335 WP_000027835.1 1824097..1824285(-) (prx) [Streptococcus agalactiae strain NCTC8184]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |