Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EW023_RS04160 | Genome accession | NZ_LR130239 |
| Coordinates | 790816..791004 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain PS003 isolate PS003 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 743044..799397 | 790816..791004 | within | 0 |
Gene organization within MGE regions
Location: 743044..799397
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW023_RS03840 | recJ | 743044..745254 (+) | 2211 | WP_023611979.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EW023_RS03845 | - | 745404..745922 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| EW023_RS03850 | - | 746003..746686 (+) | 684 | WP_002984890.1 | DnaD domain-containing protein | - |
| EW023_RS03855 | nth | 746683..747339 (+) | 657 | WP_010922193.1 | endonuclease III | - |
| EW023_RS03860 | - | 747411..748097 (+) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| EW023_RS03865 | - | 748087..748875 (+) | 789 | WP_023611986.1 | Nif3-like dinuclear metal center hexameric protein | - |
| EW023_RS03870 | - | 748915..750024 (+) | 1110 | WP_023612028.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| EW023_RS03875 | rfbA | 750082..750951 (+) | 870 | WP_023612014.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| EW023_RS03880 | - | 750951..751544 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| EW023_RS03885 | rfbB | 751788..752828 (+) | 1041 | WP_023612000.1 | dTDP-glucose 4,6-dehydratase | - |
| EW023_RS03890 | - | 752911..754050 (-) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| EW023_RS03895 | - | 754172..754858 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| EW023_RS09705 | - | 755029..755181 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| EW023_RS03900 | - | 755192..755569 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EW023_RS03905 | - | 755553..755912 (-) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| EW023_RS03910 | - | 756101..756319 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| EW023_RS03915 | - | 756414..756665 (+) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| EW023_RS09915 | - | 756696..756830 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| EW023_RS03920 | - | 756846..757160 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| EW023_RS03925 | - | 757308..757790 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| EW023_RS03930 | - | 757791..758471 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| EW023_RS03935 | - | 758573..759802 (+) | 1230 | WP_032461508.1 | DEAD/DEAH box helicase | - |
| EW023_RS03940 | - | 759818..760276 (+) | 459 | WP_011527544.1 | DUF669 domain-containing protein | - |
| EW023_RS03945 | - | 760279..761091 (+) | 813 | WP_050336142.1 | bifunctional DNA primase/polymerase | - |
| EW023_RS03950 | - | 761081..762556 (+) | 1476 | WP_011527546.1 | phage/plasmid primase, P4 family | - |
| EW023_RS03955 | - | 762818..763231 (+) | 414 | WP_011527547.1 | hypothetical protein | - |
| EW023_RS03960 | - | 763228..763548 (+) | 321 | WP_011527548.1 | VRR-NUC domain-containing protein | - |
| EW023_RS03965 | - | 763532..763888 (+) | 357 | WP_011054816.1 | hypothetical protein | - |
| EW023_RS09965 | - | 763885..764136 (+) | 252 | WP_011106665.1 | hypothetical protein | - |
| EW023_RS03975 | - | 764130..764414 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| EW023_RS03980 | - | 764411..764680 (+) | 270 | WP_023610894.1 | hypothetical protein | - |
| EW023_RS03985 | - | 764690..764974 (+) | 285 | WP_032465981.1 | hypothetical protein | - |
| EW023_RS03990 | - | 764979..765179 (+) | 201 | WP_032465979.1 | hypothetical protein | - |
| EW023_RS03995 | - | 765192..765593 (+) | 402 | WP_050336432.1 | hypothetical protein | - |
| EW023_RS04000 | - | 765593..766228 (+) | 636 | WP_002987471.1 | N-6 DNA methylase | - |
| EW023_RS04005 | - | 766501..766941 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EW023_RS04015 | - | 767460..767840 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| EW023_RS04020 | - | 767830..769104 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| EW023_RS04025 | - | 769104..770429 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| EW023_RS04030 | - | 770398..771306 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| EW023_RS04035 | - | 771313..771534 (+) | 222 | Protein_734 | hypothetical protein | - |
| EW023_RS04040 | - | 771654..772223 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| EW023_RS04045 | - | 772242..773132 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| EW023_RS04050 | - | 773144..773437 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| EW023_RS04055 | - | 773451..773795 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| EW023_RS04060 | - | 773792..774103 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| EW023_RS04065 | - | 774100..774495 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| EW023_RS04070 | - | 774497..774907 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| EW023_RS04075 | - | 774919..775425 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| EW023_RS04080 | - | 775438..775755 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| EW023_RS04085 | - | 775887..776186 (+) | 300 | WP_228637123.1 | hypothetical protein | - |
| EW023_RS04090 | - | 776179..777984 (+) | 1806 | WP_011528565.1 | tail protein | - |
| EW023_RS04095 | - | 777985..779469 (+) | 1485 | WP_050336168.1 | distal tail protein Dit | - |
| EW023_RS04100 | - | 779470..782919 (+) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| EW023_RS04105 | - | 782924..784786 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| EW023_RS04110 | - | 784797..785144 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| EW023_RS09920 | - | 785158..785280 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| EW023_RS04115 | - | 785294..785617 (+) | 324 | WP_050336175.1 | hypothetical protein | - |
| EW023_RS04120 | - | 785617..785949 (+) | 333 | WP_011054798.1 | phage holin | - |
| EW023_RS04125 | - | 785951..786715 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| EW023_RS04130 | - | 786727..787329 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| EW023_RS04135 | - | 787340..788113 (+) | 774 | WP_129758826.1 | hypothetical protein | - |
| EW023_RS04140 | - | 788123..788344 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| EW023_RS04145 | - | 788344..789003 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| EW023_RS04150 | - | 789072..789506 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| EW023_RS04155 | sda3 | 789778..790578 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EW023_RS04160 | prx | 790816..791004 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| EW023_RS04165 | - | 791412..791888 (+) | 477 | WP_002984880.1 | NUDIX hydrolase | - |
| EW023_RS04170 | - | 791946..793127 (+) | 1182 | WP_011284730.1 | AI-2E family transporter | - |
| EW023_RS04175 | - | 793117..794364 (+) | 1248 | WP_050336178.1 | tetratricopeptide repeat protein | - |
| EW023_RS04180 | fbp54 | 794423..796075 (-) | 1653 | WP_023612033.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| EW023_RS04185 | trpX | 796429..797427 (+) | 999 | WP_023612043.1 | tryptophan ABC transporter substrate-binding protein | - |
| EW023_RS04195 | - | 797773..798642 (+) | 870 | WP_002989993.1 | ABC transporter permease | - |
| EW023_RS04200 | - | 798639..799397 (+) | 759 | WP_002989991.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=1116680 EW023_RS04160 WP_011528571.1 790816..791004(+) (prx) [Streptococcus pyogenes strain PS003 isolate PS003]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=1116680 EW023_RS04160 WP_011528571.1 790816..791004(+) (prx) [Streptococcus pyogenes strain PS003 isolate PS003]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |