Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EW025_RS06355 | Genome accession | NZ_LR130238 |
| Coordinates | 1229820..1230002 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain HKU419 isolate HKU419 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1229820..1264830 | 1229820..1230002 | within | 0 |
Gene organization within MGE regions
Location: 1229820..1264830
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW025_RS06355 | prx | 1229820..1230002 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| EW025_RS06360 | sda3 | 1230241..1231041 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EW025_RS06365 | - | 1231312..1231746 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| EW025_RS06370 | - | 1231816..1233021 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| EW025_RS06375 | - | 1233137..1233364 (-) | 228 | WP_003058873.1 | phage holin | - |
| EW025_RS06380 | - | 1233361..1233636 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| EW025_RS06385 | - | 1233646..1234263 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| EW025_RS06390 | - | 1234260..1234697 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| EW025_RS06395 | - | 1234709..1236325 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| EW025_RS10525 | - | 1236332..1236577 (-) | 246 | Protein_1182 | phage tail spike protein | - |
| EW025_RS06400 | - | 1236574..1237269 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| EW025_RS06405 | - | 1237266..1239623 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| EW025_RS06410 | - | 1239623..1239994 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| EW025_RS06415 | - | 1240009..1240272 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| EW025_RS06420 | - | 1240283..1240876 (-) | 594 | WP_010922456.1 | tail protein | - |
| EW025_RS06425 | - | 1240888..1241223 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| EW025_RS06430 | - | 1241224..1241460 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| EW025_RS06435 | - | 1241453..1241791 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| EW025_RS06440 | - | 1241751..1242173 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| EW025_RS06445 | - | 1242183..1242383 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| EW025_RS06450 | - | 1242383..1243294 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| EW025_RS06455 | - | 1243319..1243780 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| EW025_RS06460 | - | 1243861..1245276 (-) | 1416 | WP_011285619.1 | terminase | - |
| EW025_RS06465 | - | 1245386..1245652 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| EW025_RS06470 | - | 1245645..1245824 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| EW025_RS06475 | - | 1245874..1246098 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| EW025_RS06480 | - | 1246104..1247597 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| EW025_RS06485 | - | 1247590..1248858 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| EW025_RS06490 | - | 1248855..1249211 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| EW025_RS06495 | - | 1249360..1249704 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| EW025_RS06500 | - | 1249813..1250232 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| EW025_RS06505 | - | 1250500..1251135 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| EW025_RS06510 | - | 1251137..1251406 (-) | 270 | WP_049525058.1 | hypothetical protein | - |
| EW025_RS06515 | - | 1251490..1252002 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| EW025_RS06520 | - | 1251999..1252340 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| EW025_RS10170 | - | 1252518..1252685 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| EW025_RS06525 | - | 1252695..1253492 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| EW025_RS06530 | - | 1253489..1254418 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| EW025_RS06535 | - | 1254421..1254750 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| EW025_RS06540 | - | 1254806..1255012 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| EW025_RS06545 | - | 1255021..1255161 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| EW025_RS06550 | - | 1255158..1255391 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| EW025_RS06555 | - | 1255372..1255761 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| EW025_RS10355 | - | 1255906..1256145 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| EW025_RS06565 | - | 1256245..1256430 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| EW025_RS06570 | - | 1256432..1256743 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| EW025_RS06575 | - | 1256821..1257006 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| EW025_RS06580 | - | 1257173..1257412 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| EW025_RS06585 | - | 1257554..1258360 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| EW025_RS06590 | - | 1258295..1258561 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| EW025_RS06595 | - | 1258593..1259309 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| EW025_RS06600 | - | 1259321..1259512 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| EW025_RS06605 | - | 1260148..1260243 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| EW025_RS06610 | - | 1260666..1261013 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| EW025_RS06615 | - | 1261017..1261397 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EW025_RS06620 | - | 1261409..1261675 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| EW025_RS06625 | - | 1261799..1262941 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| EW025_RS06630 | - | 1263031..1263306 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| EW025_RS06635 | - | 1263405..1263992 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| EW025_RS06640 | - | 1263970..1264812 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1116622 EW025_RS06355 WP_011017964.1 1229820..1230002(-) (prx) [Streptococcus pyogenes strain HKU419 isolate HKU419]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1116622 EW025_RS06355 WP_011017964.1 1229820..1230002(-) (prx) [Streptococcus pyogenes strain HKU419 isolate HKU419]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |