Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EW024_RS05990 | Genome accession | NZ_LR130237 |
| Coordinates | 1172548..1172730 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain SP444 isolate SP444 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1172548..1204658 | 1172548..1172730 | within | 0 |
Gene organization within MGE regions
Location: 1172548..1204658
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW024_RS05990 | prx | 1172548..1172730 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| EW024_RS05995 | entC3 | 1172843..1173625 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| EW024_RS06000 | - | 1173873..1174997 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| EW024_RS06005 | - | 1175133..1176350 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| EW024_RS06010 | - | 1176469..1176696 (-) | 228 | WP_003058873.1 | phage holin | - |
| EW024_RS06015 | - | 1176693..1176965 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| EW024_RS06020 | - | 1176977..1177609 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| EW024_RS06025 | - | 1177612..1178040 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| EW024_RS06030 | - | 1178049..1179830 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| EW024_RS06035 | hylP | 1179845..1180960 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| EW024_RS06040 | - | 1180957..1182933 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| EW024_RS06045 | - | 1182915..1183610 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| EW024_RS06050 | - | 1183607..1185964 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| EW024_RS06055 | - | 1185964..1186335 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| EW024_RS06060 | - | 1186350..1186613 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| EW024_RS06065 | - | 1186624..1187202 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| EW024_RS06075 | - | 1187326..1187661 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| EW024_RS06080 | - | 1187662..1187898 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| EW024_RS06085 | - | 1187891..1188228 (-) | 338 | Protein_1121 | hypothetical protein | - |
| EW024_RS06090 | - | 1188188..1188610 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| EW024_RS06095 | - | 1188620..1188820 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| EW024_RS06100 | - | 1188820..1189731 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| EW024_RS06105 | - | 1189756..1190217 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| EW024_RS06110 | - | 1190297..1191712 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| EW024_RS06115 | - | 1191794..1192030 (-) | 237 | Protein_1127 | hypothetical protein | - |
| EW024_RS06120 | - | 1192032..1192298 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| EW024_RS06125 | - | 1192350..1192574 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| EW024_RS06130 | - | 1192580..1194073 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| EW024_RS06135 | - | 1194066..1195334 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| EW024_RS06140 | - | 1195331..1195687 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| EW024_RS06145 | - | 1195835..1196179 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| EW024_RS06150 | - | 1196287..1196706 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| EW024_RS06155 | - | 1196885..1197212 (-) | 328 | Protein_1135 | recombinase RecT | - |
| EW024_RS06160 | - | 1197215..1197544 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| EW024_RS06165 | - | 1197600..1197806 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| EW024_RS06170 | - | 1197815..1197955 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| EW024_RS06175 | - | 1197952..1198186 (-) | 235 | Protein_1139 | hypothetical protein | - |
| EW024_RS06180 | - | 1198167..1198370 (-) | 204 | Protein_1140 | DNA replication protein | - |
| EW024_RS06185 | - | 1198367..1198963 (+) | 597 | Protein_1141 | tyrosine-type recombinase/integrase | - |
| EW024_RS06190 | - | 1199052..1199327 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| EW024_RS06195 | - | 1199426..1200013 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| EW024_RS06200 | - | 1199991..1200833 (-) | 843 | WP_172594861.1 | SGNH/GDSL hydrolase family protein | - |
| EW024_RS06205 | - | 1200826..1201665 (-) | 840 | WP_002989125.1 | DegV family protein | - |
| EW024_RS06210 | - | 1201893..1202825 (-) | 933 | WP_011528800.1 | LPXTG cell wall anchor domain-containing protein | - |
| EW024_RS06215 | recN | 1202997..1204658 (-) | 1662 | WP_002983909.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=1116573 EW024_RS05990 WP_011528776.1 1172548..1172730(-) (prx) [Streptococcus pyogenes strain SP444 isolate SP444]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1116573 EW024_RS05990 WP_011528776.1 1172548..1172730(-) (prx) [Streptococcus pyogenes strain SP444 isolate SP444]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |