Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EW024_RS04180 | Genome accession | NZ_LR130237 |
| Coordinates | 793382..793570 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain SP444 isolate SP444 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 763687..793570 | 793382..793570 | within | 0 |
Gene organization within MGE regions
Location: 763687..793570
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW024_RS03995 | recJ | 763687..765897 (+) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EW024_RS04000 | - | 766048..766566 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| EW024_RS04005 | - | 766647..767330 (+) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| EW024_RS04010 | nth | 767327..767983 (+) | 657 | WP_002990106.1 | endonuclease III | - |
| EW024_RS04015 | - | 768055..768741 (+) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| EW024_RS04020 | - | 768731..769519 (+) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| EW024_RS04025 | - | 769559..770665 (+) | 1107 | WP_011528537.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| EW024_RS04030 | rfbA | 770723..771592 (+) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| EW024_RS04035 | - | 771592..772185 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| EW024_RS04040 | rfbB | 772429..773469 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| EW024_RS04045 | - | 773552..774487 (-) | 936 | WP_060388510.1 | tyrosine-type recombinase/integrase | - |
| EW024_RS04050 | - | 774634..774954 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| EW024_RS04055 | - | 774938..775294 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| EW024_RS09520 | - | 775291..775542 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| EW024_RS04065 | - | 775551..775760 (+) | 210 | Protein_732 | DUF4355 domain-containing protein | - |
| EW024_RS04070 | - | 775779..776669 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| EW024_RS04075 | - | 776681..776974 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| EW024_RS04080 | - | 776988..777332 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| EW024_RS04085 | - | 777329..777640 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| EW024_RS04090 | - | 777637..778032 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| EW024_RS04095 | - | 778034..778444 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| EW024_RS04100 | - | 778459..778713 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| EW024_RS04105 | - | 778726..779016 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| EW024_RS04110 | - | 778973..780550 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| EW024_RS04115 | - | 780551..782035 (+) | 1485 | Protein_742 | distal tail protein Dit | - |
| EW024_RS04120 | - | 782036..785485 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| EW024_RS04125 | - | 785490..787352 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| EW024_RS04130 | - | 787363..787710 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| EW024_RS09480 | - | 787724..787846 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| EW024_RS04135 | - | 787860..788183 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| EW024_RS04140 | - | 788183..788515 (+) | 333 | WP_011054798.1 | phage holin | - |
| EW024_RS04145 | - | 788517..789281 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| EW024_RS04150 | - | 789293..789895 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| EW024_RS04155 | - | 789906..790679 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| EW024_RS04160 | - | 790689..790910 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| EW024_RS04165 | - | 790910..791569 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| EW024_RS04170 | - | 791638..792072 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| EW024_RS04175 | sda3 | 792344..793144 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EW024_RS04180 | prx | 793382..793570 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=1116567 EW024_RS04180 WP_011528571.1 793382..793570(+) (prx) [Streptococcus pyogenes strain SP444 isolate SP444]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=1116567 EW024_RS04180 WP_011528571.1 793382..793570(+) (prx) [Streptococcus pyogenes strain SP444 isolate SP444]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |