Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EW021_RS07275 | Genome accession | NZ_LR130236 |
| Coordinates | 1402447..1402626 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 5448 isolate 5448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1402447..1443063 | 1402447..1402626 | within | 0 |
Gene organization within MGE regions
Location: 1402447..1443063
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW021_RS07275 | prx | 1402447..1402626 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| EW021_RS07280 | sda1 | 1402865..1404037 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| EW021_RS07285 | - | 1404153..1405349 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| EW021_RS07290 | - | 1405460..1405645 (-) | 186 | WP_002988802.1 | holin | - |
| EW021_RS07295 | - | 1405642..1405941 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| EW021_RS07300 | - | 1405952..1406572 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| EW021_RS07305 | - | 1406575..1406736 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| EW021_RS07310 | - | 1406745..1408652 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| EW021_RS07315 | - | 1408663..1409298 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| EW021_RS07320 | - | 1409298..1410353 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| EW021_RS07325 | - | 1410350..1412332 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| EW021_RS07330 | - | 1412342..1413184 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| EW021_RS07335 | - | 1413196..1417578 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| EW021_RS07340 | - | 1417593..1417826 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| EW021_RS07345 | - | 1417901..1418356 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| EW021_RS07350 | - | 1418410..1419009 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| EW021_RS07355 | - | 1419021..1419380 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| EW021_RS07360 | - | 1419384..1419728 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EW021_RS07365 | - | 1419725..1420003 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| EW021_RS07370 | - | 1420014..1420370 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| EW021_RS07375 | - | 1420382..1421269 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| EW021_RS07380 | - | 1421282..1421851 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| EW021_RS07385 | - | 1422007..1422273 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| EW021_RS07390 | - | 1422276..1422464 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| EW021_RS07395 | - | 1422495..1423940 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| EW021_RS07400 | - | 1423900..1425432 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| EW021_RS07405 | - | 1425448..1426725 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| EW021_RS07410 | - | 1426715..1427167 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| EW021_RS07415 | - | 1427257..1427673 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| EW021_RS07420 | - | 1427670..1427861 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| EW021_RS07425 | - | 1427851..1428702 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| EW021_RS07430 | - | 1428711..1428977 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| EW021_RS09480 | - | 1428974..1429141 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| EW021_RS07435 | - | 1429142..1430464 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| EW021_RS07440 | - | 1430461..1430736 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| EW021_RS07445 | - | 1431123..1433507 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| EW021_RS07450 | - | 1433512..1435434 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| EW021_RS07455 | - | 1435477..1436034 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| EW021_RS07460 | - | 1436045..1436443 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| EW021_RS07465 | - | 1436447..1437601 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| EW021_RS07470 | - | 1437601..1437900 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| EW021_RS07475 | - | 1437988..1438191 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| EW021_RS07480 | - | 1438337..1438723 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| EW021_RS07485 | - | 1438720..1438923 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| EW021_RS07490 | - | 1438916..1439086 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| EW021_RS07495 | - | 1439083..1439358 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| EW021_RS07500 | - | 1439420..1439635 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| EW021_RS07505 | - | 1439683..1440096 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| EW021_RS09485 | - | 1440077..1440232 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| EW021_RS07510 | - | 1440558..1440908 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| EW021_RS07515 | - | 1440922..1441305 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EW021_RS07520 | - | 1441316..1441867 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| EW021_RS07525 | - | 1441984..1443063 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1116518 EW021_RS07275 WP_002988813.1 1402447..1402626(-) (prx) [Streptococcus pyogenes strain 5448 isolate 5448]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1116518 EW021_RS07275 WP_002988813.1 1402447..1402626(-) (prx) [Streptococcus pyogenes strain 5448 isolate 5448]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |