Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EW021_RS05985 | Genome accession | NZ_LR130236 |
| Coordinates | 1162770..1162952 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 5448 isolate 5448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1162770..1196256 | 1162770..1162952 | within | 0 |
Gene organization within MGE regions
Location: 1162770..1196256
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW021_RS05985 | prx | 1162770..1162952 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| EW021_RS05990 | sda3 | 1163191..1163991 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EW021_RS05995 | - | 1164262..1164696 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| EW021_RS06000 | - | 1164766..1165971 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| EW021_RS06005 | - | 1166087..1166314 (-) | 228 | WP_003058873.1 | phage holin | - |
| EW021_RS06010 | - | 1166311..1166586 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| EW021_RS06015 | - | 1166596..1167213 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| EW021_RS06020 | - | 1167210..1167647 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| EW021_RS06025 | - | 1167659..1169527 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| EW021_RS06030 | - | 1169524..1170219 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| EW021_RS06035 | - | 1170216..1172573 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| EW021_RS06040 | - | 1172573..1172944 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| EW021_RS06045 | - | 1172959..1173222 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| EW021_RS06050 | - | 1173233..1173826 (-) | 594 | WP_010922456.1 | tail protein | - |
| EW021_RS06055 | - | 1173838..1174173 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| EW021_RS06060 | - | 1174174..1174410 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| EW021_RS06065 | - | 1174403..1174741 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| EW021_RS06070 | - | 1174701..1175123 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| EW021_RS06075 | - | 1175133..1175333 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| EW021_RS06080 | - | 1175333..1176244 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| EW021_RS06085 | - | 1176269..1176730 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| EW021_RS06090 | - | 1176811..1178226 (-) | 1416 | WP_011285619.1 | terminase | - |
| EW021_RS06095 | - | 1178336..1178602 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| EW021_RS06100 | - | 1178595..1178774 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| EW021_RS06105 | - | 1178824..1179048 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| EW021_RS06110 | - | 1179054..1180547 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| EW021_RS06115 | - | 1180540..1181808 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| EW021_RS06120 | - | 1181805..1182161 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| EW021_RS06125 | - | 1182310..1182654 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| EW021_RS06130 | - | 1182763..1183182 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| EW021_RS06135 | - | 1183450..1184085 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| EW021_RS06140 | - | 1184087..1184356 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| EW021_RS06145 | - | 1184440..1184952 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| EW021_RS06150 | - | 1184949..1185290 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| EW021_RS09460 | - | 1185468..1185635 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| EW021_RS06155 | - | 1185645..1186442 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| EW021_RS06160 | - | 1186439..1187368 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| EW021_RS06165 | - | 1187371..1187700 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| EW021_RS06170 | - | 1187756..1187962 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| EW021_RS06175 | - | 1187971..1188111 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| EW021_RS06180 | - | 1188108..1188341 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| EW021_RS06185 | - | 1188322..1188711 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| EW021_RS09620 | - | 1188856..1189095 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| EW021_RS06195 | - | 1189195..1189380 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| EW021_RS06200 | - | 1189382..1189693 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| EW021_RS06205 | - | 1189771..1189956 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| EW021_RS06210 | - | 1190123..1190362 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| EW021_RS06215 | - | 1190504..1191310 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| EW021_RS06220 | - | 1191245..1191511 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| EW021_RS06225 | - | 1191543..1192259 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| EW021_RS06230 | - | 1192271..1192462 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| EW021_RS06235 | - | 1193098..1193193 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| EW021_RS06240 | - | 1193616..1193963 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| EW021_RS06245 | - | 1193967..1194347 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EW021_RS06250 | - | 1194359..1194625 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| EW021_RS06255 | - | 1194749..1195891 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| EW021_RS06260 | - | 1195981..1196256 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1116511 EW021_RS05985 WP_011017964.1 1162770..1162952(-) (prx) [Streptococcus pyogenes strain 5448 isolate 5448]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1116511 EW021_RS05985 WP_011017964.1 1162770..1162952(-) (prx) [Streptococcus pyogenes strain 5448 isolate 5448]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |