Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SP119_RS07460 | Genome accession | NZ_LR031521 |
| Coordinates | 1425575..1425754 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain S119 isolate S119 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1425575..1466191 | 1425575..1425754 | within | 0 |
Gene organization within MGE regions
Location: 1425575..1466191
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP119_RS07460 (SP119_1410) | prx | 1425575..1425754 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| SP119_RS07465 (SP119_1411) | sda1 | 1425993..1427165 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| SP119_RS07470 (SP119_1412) | - | 1427281..1428477 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| SP119_RS07475 (SP119_1413) | - | 1428588..1428773 (-) | 186 | WP_002988802.1 | holin | - |
| SP119_RS07480 (SP119_1414) | - | 1428770..1429069 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| SP119_RS07485 (SP119_1415) | - | 1429080..1429700 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| SP119_RS07490 (SP119_1416) | - | 1429703..1429864 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| SP119_RS07495 (SP119_1417) | - | 1429873..1431780 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| SP119_RS07500 (SP119_1418) | - | 1431791..1432426 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| SP119_RS07505 (SP119_1419) | - | 1432426..1433481 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| SP119_RS07510 (SP119_1420) | - | 1433478..1435460 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| SP119_RS07515 (SP119_1421) | - | 1435470..1436312 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| SP119_RS07520 (SP119_1422) | - | 1436324..1440706 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| SP119_RS07525 (SP119_1423) | - | 1440721..1440954 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| SP119_RS07530 (SP119_1424) | - | 1441029..1441484 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| SP119_RS07535 (SP119_1425) | - | 1441538..1442137 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| SP119_RS07540 (SP119_1426) | - | 1442149..1442508 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| SP119_RS07545 (SP119_1427) | - | 1442512..1442856 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SP119_RS07550 (SP119_1428) | - | 1442853..1443131 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| SP119_RS07555 (SP119_1429) | - | 1443142..1443498 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| SP119_RS07560 (SP119_1430) | - | 1443510..1444397 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| SP119_RS07565 (SP119_1431) | - | 1444410..1444979 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| SP119_RS07570 (SP119_1432) | - | 1445135..1445401 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| SP119_RS07575 (SP119_1433) | - | 1445404..1445592 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| SP119_RS07580 (SP119_1434) | - | 1445623..1447068 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| SP119_RS07585 (SP119_1435) | - | 1447028..1448560 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| SP119_RS07590 (SP119_1436) | - | 1448576..1449853 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| SP119_RS07595 (SP119_1437) | - | 1449843..1450295 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| SP119_RS07600 (SP119_1438) | - | 1450385..1450801 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| SP119_RS07605 (SP119_1439) | - | 1450798..1450989 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| SP119_RS07610 (SP119_1440) | - | 1450979..1451830 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| SP119_RS07615 (SP119_1441) | - | 1451839..1452105 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| SP119_RS09810 (SP119_1442) | - | 1452102..1452269 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| SP119_RS07620 (SP119_1443) | - | 1452270..1453592 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| SP119_RS07625 (SP119_1444) | - | 1453589..1453864 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| SP119_RS07630 (SP119_1445) | - | 1454251..1456635 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| SP119_RS07635 (SP119_1446) | - | 1456640..1458562 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| SP119_RS07640 (SP119_1447) | - | 1458605..1459162 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| SP119_RS07645 (SP119_1448) | - | 1459173..1459571 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| SP119_RS07650 (SP119_1449) | - | 1459575..1460729 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| SP119_RS07655 (SP119_1450) | - | 1460729..1461028 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| SP119_RS07660 (SP119_1451) | - | 1461116..1461319 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| SP119_RS07665 (SP119_1453) | - | 1461465..1461851 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| SP119_RS07670 (SP119_1454) | - | 1461848..1462051 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| SP119_RS07675 (SP119_1455) | - | 1462044..1462214 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| SP119_RS07680 (SP119_1456) | - | 1462211..1462486 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| SP119_RS07685 (SP119_1457) | - | 1462548..1462763 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| SP119_RS07690 (SP119_1458) | - | 1462811..1463224 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| SP119_RS09815 (SP119_1459) | - | 1463205..1463360 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| SP119_RS07695 (SP119_1460) | - | 1463686..1464036 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| SP119_RS07700 (SP119_1461) | - | 1464050..1464433 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SP119_RS07705 (SP119_1462) | - | 1464444..1464995 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| SP119_RS07710 (SP119_1463) | - | 1465112..1466191 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1116155 SP119_RS07460 WP_002988813.1 1425575..1425754(-) (prx) [Streptococcus pyogenes strain S119 isolate S119]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1116155 SP119_RS07460 WP_002988813.1 1425575..1425754(-) (prx) [Streptococcus pyogenes strain S119 isolate S119]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |