Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SP119_RS06170 | Genome accession | NZ_LR031521 |
| Coordinates | 1185898..1186080 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain S119 isolate S119 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1185898..1220908 | 1185898..1186080 | within | 0 |
Gene organization within MGE regions
Location: 1185898..1220908
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP119_RS06170 (SP119_1169) | prx | 1185898..1186080 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| SP119_RS06175 (SP119_1170) | sda3 | 1186319..1187119 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SP119_RS06180 (SP119_1171) | - | 1187390..1187824 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| SP119_RS06185 (SP119_1172) | - | 1187894..1189099 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| SP119_RS06190 (SP119_1173) | - | 1189215..1189442 (-) | 228 | WP_003058873.1 | phage holin | - |
| SP119_RS06195 (SP119_1174) | - | 1189439..1189714 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| SP119_RS06200 (SP119_1175) | - | 1189724..1190341 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| SP119_RS06205 (SP119_1176) | - | 1190338..1190775 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| SP119_RS06210 (SP119_1177) | - | 1190787..1192655 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| SP119_RS06215 (SP119_1178) | - | 1192652..1193347 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| SP119_RS06220 (SP119_1179) | - | 1193344..1195701 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| SP119_RS06225 (SP119_1180) | - | 1195701..1196072 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| SP119_RS06230 (SP119_1181) | - | 1196087..1196350 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SP119_RS06235 (SP119_1182) | - | 1196361..1196954 (-) | 594 | WP_010922456.1 | tail protein | - |
| SP119_RS06240 (SP119_1183) | - | 1196966..1197301 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| SP119_RS06245 (SP119_1184) | - | 1197302..1197538 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| SP119_RS06250 (SP119_1185) | - | 1197531..1197869 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| SP119_RS06255 (SP119_1186) | - | 1197829..1198251 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SP119_RS06260 (SP119_1187) | - | 1198261..1198461 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| SP119_RS06265 (SP119_1188) | - | 1198461..1199372 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| SP119_RS06270 (SP119_1189) | - | 1199397..1199858 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SP119_RS06275 (SP119_1190) | - | 1199939..1201354 (-) | 1416 | WP_011285619.1 | terminase | - |
| SP119_RS06280 (SP119_1191) | - | 1201464..1201730 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| SP119_RS06285 (SP119_1192) | - | 1201723..1201902 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| SP119_RS06290 (SP119_1193) | - | 1201952..1202176 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| SP119_RS06295 (SP119_1194) | - | 1202182..1203675 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| SP119_RS06300 (SP119_1195) | - | 1203668..1204936 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| SP119_RS06305 (SP119_1196) | - | 1204933..1205289 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SP119_RS06310 (SP119_1197) | - | 1205438..1205782 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| SP119_RS06315 (SP119_1198) | - | 1205891..1206310 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| SP119_RS06320 (SP119_1199) | - | 1206578..1207213 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| SP119_RS06325 (SP119_1200) | - | 1207215..1207484 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| SP119_RS06330 (SP119_1201) | - | 1207568..1208080 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| SP119_RS06335 (SP119_1202) | - | 1208077..1208418 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| SP119_RS09790 (SP119_1203) | - | 1208596..1208763 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| SP119_RS06340 (SP119_1204) | - | 1208773..1209570 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SP119_RS06345 (SP119_1205) | - | 1209567..1210496 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| SP119_RS06350 (SP119_1206) | - | 1210499..1210828 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| SP119_RS06355 (SP119_1207) | - | 1210884..1211090 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| SP119_RS06360 (SP119_1208) | - | 1211099..1211239 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| SP119_RS06365 (SP119_1209) | - | 1211236..1211469 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| SP119_RS06370 (SP119_1210) | - | 1211450..1211839 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| SP119_RS09935 | - | 1211984..1212223 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| SP119_RS06380 (SP119_1211) | - | 1212323..1212508 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| SP119_RS06385 (SP119_1212) | - | 1212510..1212821 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| SP119_RS06390 (SP119_1213) | - | 1212899..1213084 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| SP119_RS06395 (SP119_1214) | - | 1213251..1213490 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| SP119_RS06400 (SP119_1215) | - | 1213632..1214438 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| SP119_RS06405 | - | 1214373..1214639 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| SP119_RS06410 (SP119_1216) | - | 1214671..1215387 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| SP119_RS06415 (SP119_1217) | - | 1215399..1215590 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| SP119_RS06420 (SP119_1218) | - | 1216226..1216321 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| SP119_RS06425 (SP119_1219) | - | 1216744..1217091 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| SP119_RS06430 (SP119_1220) | - | 1217095..1217475 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SP119_RS06435 (SP119_1221) | - | 1217487..1217753 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| SP119_RS06440 (SP119_1222) | - | 1217877..1219019 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SP119_RS06445 (SP119_1223) | - | 1219109..1219384 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SP119_RS06450 (SP119_1224) | - | 1219483..1220070 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| SP119_RS06455 (SP119_1225) | - | 1220048..1220890 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1116148 SP119_RS06170 WP_011017964.1 1185898..1186080(-) (prx) [Streptococcus pyogenes strain S119 isolate S119]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1116148 SP119_RS06170 WP_011017964.1 1185898..1186080(-) (prx) [Streptococcus pyogenes strain S119 isolate S119]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |