Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | GBSCOH1_RS10510 | Genome accession | NZ_HG939456 |
| Coordinates | 571937..572125 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae COH1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 563151..571895 | 571937..572125 | flank | 42 |
| IS/Tn | 570870..571481 | 571937..572125 | flank | 456 |
Gene organization within MGE regions
Location: 563151..572125
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GBSCOH1_RS10505 (GBSCOH1_0533) | - | 564530..564691 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| GBSCOH1_RS03090 (GBSCOH1_0534) | - | 565433..566710 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| GBSCOH1_RS03095 (GBSCOH1_0535) | - | 566720..567376 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| GBSCOH1_RS03100 (GBSCOH1_0536) | - | 567376..568752 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| GBSCOH1_RS03105 (GBSCOH1_0537) | - | 568849..569502 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| GBSCOH1_RS03110 (GBSCOH1_0538) | - | 569499..570818 (+) | 1320 | WP_000734167.1 | sensor histidine kinase | - |
| GBSCOH1_RS03115 (GBSCOH1_0539) | - | 570870..571517 (-) | 648 | Protein_531 | IS3 family transposase | - |
| GBSCOH1_RS03120 (GBSCOH1_0540) | - | 571695..571895 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| GBSCOH1_RS10510 (GBSCOH1_0541) | prx | 571937..572125 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=1112246 GBSCOH1_RS10510 WP_000027835.1 571937..572125(+) (prx) [Streptococcus agalactiae COH1]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=1112246 GBSCOH1_RS10510 WP_000027835.1 571937..572125(+) (prx) [Streptococcus agalactiae COH1]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |