Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABXG87_RS03750 | Genome accession | NZ_AP031488 |
| Coordinates | 828676..828861 (+) | Length | 61 a.a. |
| NCBI ID | WP_070839405.1 | Uniprot ID | - |
| Organism | Streptococcus salivarius strain NBRC 13956 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 824596..835601 | 828676..828861 | within | 0 |
Gene organization within MGE regions
Location: 824596..835601
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABXG87_RS03720 (Ssa13956_06760) | - | 824608..825438 (+) | 831 | WP_118172381.1 | ABC transporter ATP-binding protein | - |
| ABXG87_RS03725 (Ssa13956_06770) | - | 825431..826138 (+) | 708 | WP_118172379.1 | ABC transporter permease | - |
| ABXG87_RS03730 (Ssa13956_06780) | - | 826161..826385 (-) | 225 | Protein_676 | IS30 family transposase | - |
| ABXG87_RS03735 (Ssa13956_06790) | - | 826516..826917 (+) | 402 | WP_247924525.1 | transposase | - |
| ABXG87_RS03740 (Ssa13956_06800) | - | 827095..827334 (+) | 240 | WP_247924526.1 | transposase | - |
| ABXG87_RS03745 (Ssa13956_06810) | - | 827492..828478 (-) | 987 | WP_353551954.1 | IS30 family transposase | - |
| ABXG87_RS03750 (Ssa13956_06820) | prx | 828676..828861 (+) | 186 | WP_070839405.1 | Paratox | Regulator |
| ABXG87_RS03755 (Ssa13956_06840) | - | 829343..829720 (+) | 378 | WP_353551955.1 | helix-turn-helix transcriptional regulator | - |
| ABXG87_RS03760 | - | 829701..829793 (+) | 93 | Protein_682 | helix-turn-helix domain-containing protein | - |
| ABXG87_RS03765 (Ssa13956_06850) | - | 829914..830390 (+) | 477 | WP_353552056.1 | RDD family protein | - |
| ABXG87_RS03770 (Ssa13956_06860) | - | 830515..831435 (+) | 921 | WP_353551957.1 | multidrug resistance efflux transporter family protein | - |
| ABXG87_RS03775 (Ssa13956_06870) | - | 831690..835601 (+) | 3912 | WP_353551959.1 | GH32 C-terminal domain-containing protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 7096.11 Da Isoelectric Point: 4.1169
>NTDB_id=109792 ABXG87_RS03750 WP_070839405.1 828676..828861(+) (prx) [Streptococcus salivarius strain NBRC 13956]
MMTYDEVMEAIERGFIKGDKISIIRRNGKIHDYVLPGEKVEPGEIVEEEDLDVVLEELKEF
MMTYDEVMEAIERGFIKGDKISIIRRNGKIHDYVLPGEKVEPGEIVEEEDLDVVLEELKEF
Nucleotide
Download Length: 186 bp
>NTDB_id=109792 ABXG87_RS03750 WP_070839405.1 828676..828861(+) (prx) [Streptococcus salivarius strain NBRC 13956]
ATGATGACTTATGATGAAGTAATGGAAGCGATAGAAAGAGGGTTTATCAAGGGAGATAAAATCAGTATTATTCGACGAAA
TGGCAAAATCCATGATTATGTTTTACCAGGAGAGAAAGTAGAACCTGGAGAAATAGTGGAAGAAGAGGACTTAGATGTTG
TCCTTGAAGAGTTGAAGGAGTTCTAA
ATGATGACTTATGATGAAGTAATGGAAGCGATAGAAAGAGGGTTTATCAAGGGAGATAAAATCAGTATTATTCGACGAAA
TGGCAAAATCCATGATTATGTTTTACCAGGAGAGAAAGTAGAACCTGGAGAAATAGTGGAAGAAGAGGACTTAGATGTTG
TCCTTGAAGAGTTGAAGGAGTTCTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
54.237 |
96.721 |
0.525 |
| prx | Streptococcus pyogenes MGAS8232 |
53.448 |
95.082 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
51.724 |
95.082 |
0.492 |
| prx | Streptococcus pyogenes MGAS315 |
51.724 |
95.082 |
0.492 |
| prx | Streptococcus pyogenes MGAS315 |
61.905 |
68.852 |
0.426 |
| prx | Streptococcus pyogenes MGAS315 |
60 |
65.574 |
0.393 |
| prx | Streptococcus pyogenes MGAS315 |
53.488 |
70.492 |
0.377 |