Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACM3H0_RS06935 | Genome accession | NZ_CP180685 |
| Coordinates | 1305277..1305459 (-) | Length | 60 a.a. |
| NCBI ID | WP_000965649.1 | Uniprot ID | A0AAV3JNR0 |
| Organism | Streptococcus agalactiae strain M14 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1305277..1355080 | 1305277..1305459 | within | 0 |
Gene organization within MGE regions
Location: 1305277..1355080
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACM3H0_RS06935 (ACM3H0_06935) | prx | 1305277..1305459 (-) | 183 | WP_000965649.1 | hypothetical protein | Regulator |
| ACM3H0_RS06940 (ACM3H0_06940) | - | 1305877..1306047 (+) | 171 | WP_000356856.1 | hypothetical protein | - |
| ACM3H0_RS06945 (ACM3H0_06945) | - | 1306088..1306288 (-) | 201 | WP_000076715.1 | CsbD family protein | - |
| ACM3H0_RS06950 (ACM3H0_06950) | - | 1306397..1306696 (-) | 300 | WP_000258211.1 | STAS-like domain-containing protein | - |
| ACM3H0_RS06955 (ACM3H0_06955) | - | 1306690..1307586 (-) | 897 | WP_001061853.1 | sensor histidine kinase | - |
| ACM3H0_RS06960 (ACM3H0_06960) | - | 1307716..1309050 (-) | 1335 | WP_336317628.1 | GH25 family lysozyme | - |
| ACM3H0_RS06965 (ACM3H0_06965) | - | 1309176..1309430 (-) | 255 | WP_000611524.1 | phage holin | - |
| ACM3H0_RS06970 (ACM3H0_06970) | - | 1309432..1309734 (-) | 303 | WP_000215499.1 | hypothetical protein | - |
| ACM3H0_RS06975 (ACM3H0_06975) | - | 1309747..1309959 (-) | 213 | WP_000698337.1 | hypothetical protein | - |
| ACM3H0_RS06980 (ACM3H0_06980) | - | 1309934..1310260 (-) | 327 | WP_000404431.1 | DUF1366 domain-containing protein | - |
| ACM3H0_RS06985 (ACM3H0_06985) | - | 1310274..1312286 (-) | 2013 | WP_050977837.1 | DUF859 family phage minor structural protein | - |
| ACM3H0_RS06990 (ACM3H0_06990) | - | 1312297..1316124 (-) | 3828 | WP_050977836.1 | glucosaminidase domain-containing protein | - |
| ACM3H0_RS06995 (ACM3H0_06995) | - | 1316115..1317637 (-) | 1523 | Protein_1299 | distal tail protein Dit | - |
| ACM3H0_RS07000 (ACM3H0_07000) | - | 1317634..1321573 (-) | 3940 | Protein_1300 | phage tail tape measure protein | - |
| ACM3H0_RS07005 (ACM3H0_07005) | - | 1321586..1321753 (-) | 168 | WP_000264971.1 | hypothetical protein | - |
| ACM3H0_RS07010 (ACM3H0_07010) | gpG | 1321767..1322102 (-) | 336 | WP_410531500.1 | phage tail assembly chaperone G | - |
| ACM3H0_RS07015 (ACM3H0_07015) | - | 1322156..1322776 (-) | 621 | Protein_1303 | major tail protein | - |
| ACM3H0_RS07020 (ACM3H0_07020) | - | 1322792..1323217 (-) | 426 | WP_000559944.1 | hypothetical protein | - |
| ACM3H0_RS07025 (ACM3H0_07025) | - | 1323214..1323591 (-) | 378 | WP_000160228.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACM3H0_RS07030 (ACM3H0_07030) | - | 1323588..1323935 (-) | 348 | WP_000632972.1 | phage head closure protein | - |
| ACM3H0_RS07035 (ACM3H0_07035) | - | 1323932..1324234 (-) | 303 | WP_416055427.1 | head-tail connector protein | - |
| ACM3H0_RS07040 (ACM3H0_07040) | - | 1324370..1325551 (-) | 1182 | WP_416055428.1 | phage major capsid protein | - |
| ACM3H0_RS07045 (ACM3H0_07045) | - | 1325575..1326240 (-) | 666 | WP_071661629.1 | head maturation protease, ClpP-related | - |
| ACM3H0_RS07050 (ACM3H0_07050) | - | 1326218..1327438 (-) | 1221 | WP_000007732.1 | phage portal protein | - |
| ACM3H0_RS07055 (ACM3H0_07055) | - | 1327445..1327675 (-) | 231 | WP_001042284.1 | hypothetical protein | - |
| ACM3H0_RS07060 (ACM3H0_07060) | - | 1327672..1327839 (-) | 168 | WP_000578945.1 | hypothetical protein | - |
| ACM3H0_RS07065 (ACM3H0_07065) | - | 1327836..1329590 (-) | 1755 | WP_000151569.1 | terminase large subunit | - |
| ACM3H0_RS07070 (ACM3H0_07070) | - | 1329605..1330072 (-) | 468 | WP_000532791.1 | phage terminase small subunit P27 family | - |
| ACM3H0_RS07075 (ACM3H0_07075) | - | 1330244..1330582 (-) | 339 | WP_001247768.1 | HNH endonuclease | - |
| ACM3H0_RS07080 (ACM3H0_07080) | - | 1330683..1330868 (+) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACM3H0_RS07085 (ACM3H0_07085) | - | 1330921..1331298 (+) | 378 | WP_000964195.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACM3H0_RS07090 (ACM3H0_07090) | - | 1331352..1331480 (-) | 129 | WP_017647279.1 | hypothetical protein | - |
| ACM3H0_RS07100 (ACM3H0_07100) | - | 1332036..1332470 (-) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACM3H0_RS07105 (ACM3H0_07105) | - | 1332861..1333127 (-) | 267 | WP_416055429.1 | hypothetical protein | - |
| ACM3H0_RS07110 (ACM3H0_07110) | - | 1333145..1333444 (-) | 300 | WP_079218641.1 | hypothetical protein | - |
| ACM3H0_RS07115 (ACM3H0_07115) | - | 1333465..1333965 (-) | 501 | WP_416055430.1 | DUF1642 domain-containing protein | - |
| ACM3H0_RS07120 (ACM3H0_07120) | - | 1334228..1334668 (-) | 441 | WP_000612732.1 | YopX family protein | - |
| ACM3H0_RS07125 (ACM3H0_07125) | - | 1334817..1335104 (-) | 288 | WP_071661630.1 | nucleotide modification associated domain-containing protein | - |
| ACM3H0_RS07130 (ACM3H0_07130) | - | 1335116..1335463 (-) | 348 | WP_047200446.1 | hypothetical protein | - |
| ACM3H0_RS07135 (ACM3H0_07135) | - | 1335453..1335929 (-) | 477 | WP_000143298.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACM3H0_RS07140 (ACM3H0_07140) | - | 1335919..1336116 (-) | 198 | WP_000474006.1 | hypothetical protein | - |
| ACM3H0_RS07145 (ACM3H0_07145) | - | 1336277..1337074 (-) | 798 | WP_047200445.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACM3H0_RS07150 (ACM3H0_07150) | - | 1337071..1338051 (-) | 981 | WP_047200444.1 | recombinase RecT | - |
| ACM3H0_RS07155 (ACM3H0_07155) | - | 1338054..1338383 (-) | 330 | WP_047200443.1 | hypothetical protein | - |
| ACM3H0_RS07160 (ACM3H0_07160) | - | 1338385..1338546 (-) | 162 | WP_079398808.1 | hypothetical protein | - |
| ACM3H0_RS07165 (ACM3H0_07165) | - | 1338548..1338802 (-) | 255 | WP_047200442.1 | hypothetical protein | - |
| ACM3H0_RS07170 (ACM3H0_07170) | - | 1338789..1339064 (-) | 276 | WP_000431575.1 | hypothetical protein | - |
| ACM3H0_RS07175 (ACM3H0_07175) | - | 1339054..1339200 (-) | 147 | WP_165694407.1 | hypothetical protein | - |
| ACM3H0_RS07180 (ACM3H0_07180) | - | 1339191..1339973 (-) | 783 | WP_000600243.1 | ATP-binding protein | - |
| ACM3H0_RS07185 (ACM3H0_07185) | - | 1339960..1340718 (-) | 759 | WP_000546751.1 | DnaD domain protein | - |
| ACM3H0_RS07190 (ACM3H0_07190) | - | 1340793..1341017 (-) | 225 | WP_047208982.1 | hypothetical protein | - |
| ACM3H0_RS07195 (ACM3H0_07195) | - | 1341046..1341303 (-) | 258 | WP_016480517.1 | hypothetical protein | - |
| ACM3H0_RS07200 (ACM3H0_07200) | - | 1341413..1341721 (+) | 309 | WP_001000651.1 | hypothetical protein | - |
| ACM3H0_RS07205 (ACM3H0_07205) | - | 1341684..1341830 (-) | 147 | WP_001867241.1 | hypothetical protein | - |
| ACM3H0_RS07210 (ACM3H0_07210) | - | 1341957..1342115 (-) | 159 | WP_000392121.1 | hypothetical protein | - |
| ACM3H0_RS07215 (ACM3H0_07215) | - | 1342147..1342602 (-) | 456 | WP_001872799.1 | ORF6C domain-containing protein | - |
| ACM3H0_RS07220 (ACM3H0_07220) | - | 1342599..1343521 (-) | 923 | Protein_1343 | DUF3102 domain-containing protein | - |
| ACM3H0_RS07225 (ACM3H0_07225) | - | 1343539..1343754 (-) | 216 | WP_000164461.1 | helix-turn-helix transcriptional regulator | - |
| ACM3H0_RS07230 (ACM3H0_07230) | - | 1343830..1344165 (+) | 336 | WP_000360289.1 | hypothetical protein | - |
| ACM3H0_RS07235 (ACM3H0_07235) | - | 1344382..1345023 (+) | 642 | WP_001008979.1 | hypothetical protein | - |
| ACM3H0_RS07240 (ACM3H0_07240) | - | 1345121..1345279 (-) | 159 | WP_001104143.1 | hypothetical protein | - |
| ACM3H0_RS07245 (ACM3H0_07245) | - | 1345338..1345550 (+) | 213 | WP_000703681.1 | hypothetical protein | - |
| ACM3H0_RS07250 (ACM3H0_07250) | - | 1345539..1345688 (-) | 150 | WP_017645151.1 | hypothetical protein | - |
| ACM3H0_RS07255 (ACM3H0_07255) | - | 1346047..1346790 (+) | 744 | WP_416055431.1 | XRE family transcriptional regulator | - |
| ACM3H0_RS07260 (ACM3H0_07260) | - | 1346792..1347349 (+) | 558 | WP_000891065.1 | hypothetical protein | - |
| ACM3H0_RS07265 (ACM3H0_07265) | - | 1347521..1348414 (+) | 894 | WP_000426896.1 | P63C domain-containing protein | - |
| ACM3H0_RS07270 (ACM3H0_07270) | - | 1348587..1349684 (+) | 1098 | WP_000570847.1 | site-specific integrase | - |
| ACM3H0_RS07275 (ACM3H0_07275) | hylB | 1349964..1353182 (+) | 3219 | WP_000403417.1 | hyaluronate lyase | - |
| ACM3H0_RS07280 (ACM3H0_07280) | rfbB | 1353234..1354280 (-) | 1047 | WP_000134279.1 | dTDP-glucose 4,6-dehydratase | - |
| ACM3H0_RS07285 (ACM3H0_07285) | - | 1354487..1355080 (-) | 594 | WP_000139158.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.13 Da Isoelectric Point: 4.1954
>NTDB_id=1097427 ACM3H0_RS06935 WP_000965649.1 1305277..1305459(-) (prx) [Streptococcus agalactiae strain M14]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1097427 ACM3H0_RS06935 WP_000965649.1 1305277..1305459(-) (prx) [Streptococcus agalactiae strain M14]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS8232 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |