Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACM3H0_RS01045 | Genome accession | NZ_CP180685 |
| Coordinates | 145668..145850 (+) | Length | 60 a.a. |
| NCBI ID | WP_000965649.1 | Uniprot ID | A0AAV3JNR0 |
| Organism | Streptococcus agalactiae strain M14 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 101440..145850 | 145668..145850 | within | 0 |
Gene organization within MGE regions
Location: 101440..145850
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACM3H0_RS00705 (ACM3H0_00705) | - | 101440..102537 (-) | 1098 | WP_000570847.1 | site-specific integrase | - |
| ACM3H0_RS00710 (ACM3H0_00710) | - | 102710..103603 (-) | 894 | WP_000426896.1 | P63C domain-containing protein | - |
| ACM3H0_RS00715 (ACM3H0_00715) | - | 103775..104332 (-) | 558 | WP_000891065.1 | hypothetical protein | - |
| ACM3H0_RS00720 (ACM3H0_00720) | - | 104334..105077 (-) | 744 | WP_416055431.1 | XRE family transcriptional regulator | - |
| ACM3H0_RS00725 (ACM3H0_00725) | - | 105437..105586 (+) | 150 | WP_017645151.1 | hypothetical protein | - |
| ACM3H0_RS00730 (ACM3H0_00730) | - | 105575..105787 (-) | 213 | WP_000703681.1 | hypothetical protein | - |
| ACM3H0_RS00735 (ACM3H0_00735) | - | 105846..106004 (+) | 159 | WP_001104143.1 | hypothetical protein | - |
| ACM3H0_RS00740 (ACM3H0_00740) | - | 106102..106743 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| ACM3H0_RS00745 (ACM3H0_00745) | - | 106960..107295 (-) | 336 | WP_000360289.1 | hypothetical protein | - |
| ACM3H0_RS00750 (ACM3H0_00750) | - | 107371..107586 (+) | 216 | WP_000164461.1 | helix-turn-helix transcriptional regulator | - |
| ACM3H0_RS00755 (ACM3H0_00755) | - | 107604..108527 (+) | 924 | WP_416055441.1 | DUF3102 domain-containing protein | - |
| ACM3H0_RS00760 (ACM3H0_00760) | - | 108524..108979 (+) | 456 | WP_001872799.1 | ORF6C domain-containing protein | - |
| ACM3H0_RS00765 (ACM3H0_00765) | - | 109011..109169 (+) | 159 | WP_000392121.1 | hypothetical protein | - |
| ACM3H0_RS00770 (ACM3H0_00770) | - | 109296..109442 (+) | 147 | WP_001867241.1 | hypothetical protein | - |
| ACM3H0_RS00775 (ACM3H0_00775) | - | 109405..109713 (-) | 309 | WP_001000651.1 | hypothetical protein | - |
| ACM3H0_RS00780 (ACM3H0_00780) | - | 109823..110080 (+) | 258 | WP_016480517.1 | hypothetical protein | - |
| ACM3H0_RS00785 (ACM3H0_00785) | - | 110109..110333 (+) | 225 | WP_047208982.1 | hypothetical protein | - |
| ACM3H0_RS00790 (ACM3H0_00790) | - | 110408..111166 (+) | 759 | WP_000546751.1 | DnaD domain protein | - |
| ACM3H0_RS00795 (ACM3H0_00795) | - | 111153..111935 (+) | 783 | WP_000600243.1 | ATP-binding protein | - |
| ACM3H0_RS00800 (ACM3H0_00800) | - | 111926..112072 (+) | 147 | WP_165694407.1 | hypothetical protein | - |
| ACM3H0_RS00805 (ACM3H0_00805) | - | 112062..112337 (+) | 276 | WP_000431575.1 | hypothetical protein | - |
| ACM3H0_RS00810 (ACM3H0_00810) | - | 112324..112578 (+) | 255 | WP_047200442.1 | hypothetical protein | - |
| ACM3H0_RS00815 (ACM3H0_00815) | - | 112580..112741 (+) | 162 | WP_079398808.1 | hypothetical protein | - |
| ACM3H0_RS00820 (ACM3H0_00820) | - | 112743..113072 (+) | 330 | WP_047200443.1 | hypothetical protein | - |
| ACM3H0_RS00825 (ACM3H0_00825) | - | 113075..114055 (+) | 981 | WP_047200444.1 | recombinase RecT | - |
| ACM3H0_RS00830 (ACM3H0_00830) | - | 114052..114849 (+) | 798 | WP_047200445.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACM3H0_RS00835 (ACM3H0_00835) | - | 115010..115207 (+) | 198 | WP_000474006.1 | hypothetical protein | - |
| ACM3H0_RS00840 (ACM3H0_00840) | - | 115197..115672 (+) | 476 | Protein_117 | RusA family crossover junction endodeoxyribonuclease | - |
| ACM3H0_RS00845 (ACM3H0_00845) | - | 115662..116009 (+) | 348 | WP_047200446.1 | hypothetical protein | - |
| ACM3H0_RS00850 (ACM3H0_00850) | - | 116021..116308 (+) | 288 | WP_071661630.1 | nucleotide modification associated domain-containing protein | - |
| ACM3H0_RS00855 (ACM3H0_00855) | - | 116457..116897 (+) | 441 | WP_000612732.1 | YopX family protein | - |
| ACM3H0_RS00860 (ACM3H0_00860) | - | 117021..117164 (+) | 144 | WP_000564605.1 | hypothetical protein | - |
| ACM3H0_RS00865 (ACM3H0_00865) | - | 117161..117661 (+) | 501 | WP_416055430.1 | DUF1642 domain-containing protein | - |
| ACM3H0_RS00870 (ACM3H0_00870) | - | 117682..117981 (+) | 300 | WP_079218641.1 | hypothetical protein | - |
| ACM3H0_RS00875 (ACM3H0_00875) | - | 117999..118265 (+) | 267 | WP_416055429.1 | hypothetical protein | - |
| ACM3H0_RS00880 (ACM3H0_00880) | - | 118656..119090 (+) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACM3H0_RS00890 (ACM3H0_00890) | - | 119646..119774 (+) | 129 | WP_017647279.1 | hypothetical protein | - |
| ACM3H0_RS00895 (ACM3H0_00895) | - | 119828..120205 (-) | 378 | WP_000964195.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACM3H0_RS00900 (ACM3H0_00900) | - | 120258..120443 (-) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACM3H0_RS00905 (ACM3H0_00905) | - | 120544..120882 (+) | 339 | WP_001247768.1 | HNH endonuclease | - |
| ACM3H0_RS00910 (ACM3H0_00910) | - | 121054..121521 (+) | 468 | WP_000532791.1 | phage terminase small subunit P27 family | - |
| ACM3H0_RS00915 (ACM3H0_00915) | - | 121536..123290 (+) | 1755 | WP_000151569.1 | terminase large subunit | - |
| ACM3H0_RS00920 (ACM3H0_00920) | - | 123287..123454 (+) | 168 | WP_000578945.1 | hypothetical protein | - |
| ACM3H0_RS00925 (ACM3H0_00925) | - | 123451..123681 (+) | 231 | WP_001042284.1 | hypothetical protein | - |
| ACM3H0_RS00930 (ACM3H0_00930) | - | 123688..124908 (+) | 1221 | WP_000007732.1 | phage portal protein | - |
| ACM3H0_RS00935 (ACM3H0_00935) | - | 124886..125551 (+) | 666 | WP_071661629.1 | head maturation protease, ClpP-related | - |
| ACM3H0_RS00940 (ACM3H0_00940) | - | 125575..126756 (+) | 1182 | WP_416055428.1 | phage major capsid protein | - |
| ACM3H0_RS00945 (ACM3H0_00945) | - | 126892..127194 (+) | 303 | WP_416055427.1 | head-tail connector protein | - |
| ACM3H0_RS00950 (ACM3H0_00950) | - | 127191..127538 (+) | 348 | WP_000632972.1 | phage head closure protein | - |
| ACM3H0_RS00955 (ACM3H0_00955) | - | 127535..127912 (+) | 378 | WP_000160228.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACM3H0_RS00960 (ACM3H0_00960) | - | 127909..128334 (+) | 426 | WP_000559944.1 | hypothetical protein | - |
| ACM3H0_RS00965 (ACM3H0_00965) | - | 128350..128970 (+) | 621 | Protein_141 | major tail protein | - |
| ACM3H0_RS00970 (ACM3H0_00970) | gpG | 129024..129359 (+) | 336 | WP_410531500.1 | phage tail assembly chaperone G | - |
| ACM3H0_RS00975 (ACM3H0_00975) | - | 129373..129540 (+) | 168 | WP_000264971.1 | hypothetical protein | - |
| ACM3H0_RS00980 (ACM3H0_00980) | - | 129553..133493 (+) | 3941 | Protein_144 | phage tail tape measure protein | - |
| ACM3H0_RS00985 (ACM3H0_00985) | - | 133490..135012 (+) | 1523 | Protein_145 | distal tail protein Dit | - |
| ACM3H0_RS00990 (ACM3H0_00990) | - | 135003..138830 (+) | 3828 | WP_050977836.1 | glucosaminidase domain-containing protein | - |
| ACM3H0_RS00995 (ACM3H0_00995) | - | 138841..140853 (+) | 2013 | WP_050977837.1 | DUF859 family phage minor structural protein | - |
| ACM3H0_RS01000 (ACM3H0_01000) | - | 140867..141193 (+) | 327 | WP_000404431.1 | DUF1366 domain-containing protein | - |
| ACM3H0_RS01005 (ACM3H0_01005) | - | 141168..141380 (+) | 213 | WP_000698337.1 | hypothetical protein | - |
| ACM3H0_RS01010 (ACM3H0_01010) | - | 141393..141695 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| ACM3H0_RS01015 (ACM3H0_01015) | - | 141697..141951 (+) | 255 | WP_000611524.1 | phage holin | - |
| ACM3H0_RS01020 (ACM3H0_01020) | - | 142077..143411 (+) | 1335 | WP_336317628.1 | GH25 family lysozyme | - |
| ACM3H0_RS01025 (ACM3H0_01025) | - | 143541..144437 (+) | 897 | WP_001061853.1 | sensor histidine kinase | - |
| ACM3H0_RS01030 (ACM3H0_01030) | - | 144431..144730 (+) | 300 | WP_000258211.1 | STAS-like domain-containing protein | - |
| ACM3H0_RS01035 (ACM3H0_01035) | - | 144839..145039 (+) | 201 | WP_000076715.1 | CsbD family protein | - |
| ACM3H0_RS01040 (ACM3H0_01040) | - | 145080..145250 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| ACM3H0_RS01045 (ACM3H0_01045) | prx | 145668..145850 (+) | 183 | WP_000965649.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.13 Da Isoelectric Point: 4.1954
>NTDB_id=1097390 ACM3H0_RS01045 WP_000965649.1 145668..145850(+) (prx) [Streptococcus agalactiae strain M14]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1097390 ACM3H0_RS01045 WP_000965649.1 145668..145850(+) (prx) [Streptococcus agalactiae strain M14]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS8232 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |