Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACGHT2_RS07355 | Genome accession | NZ_AP031455 |
| Coordinates | 1402163..1402342 (-) | Length | 59 a.a. |
| NCBI ID | WP_156672679.1 | Uniprot ID | - |
| Organism | Streptococcus pasteurianus strain k46-0107-A9 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1402416..1412952 | 1402163..1402342 | flank | 74 |
Gene organization within MGE regions
Location: 1402163..1412952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACGHT2_RS07355 (K460107A9_13610) | prx | 1402163..1402342 (-) | 180 | WP_156672679.1 | Paratox | Regulator |
| ACGHT2_RS07360 (K460107A9_13620) | - | 1402416..1402925 (-) | 510 | WP_156672678.1 | PBECR4 domain-containing protein | - |
| ACGHT2_RS07365 (K460107A9_13630) | - | 1403861..1404400 (+) | 540 | WP_156672677.1 | hypothetical protein | - |
| ACGHT2_RS07370 (K460107A9_13640) | - | 1404718..1404930 (-) | 213 | WP_156672676.1 | hypothetical protein | - |
| ACGHT2_RS07375 (K460107A9_13650) | - | 1404991..1405452 (-) | 462 | WP_156672682.1 | hypothetical protein | - |
| ACGHT2_RS07380 (K460107A9_13660) | - | 1405747..1406178 (-) | 432 | WP_390578225.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACGHT2_RS07385 (K460107A9_13670) | - | 1406199..1406789 (-) | 591 | WP_390578227.1 | hypothetical protein | - |
| ACGHT2_RS07390 (K460107A9_13690) | - | 1407036..1407338 (-) | 303 | WP_316595413.1 | hypothetical protein | - |
| ACGHT2_RS07395 (K460107A9_13710) | - | 1407948..1409351 (-) | 1404 | WP_390578229.1 | VapE domain-containing protein | - |
| ACGHT2_RS07400 (K460107A9_13720) | - | 1409326..1409874 (-) | 549 | WP_390578231.1 | hypothetical protein | - |
| ACGHT2_RS07405 (K460107A9_13730) | - | 1409879..1410145 (-) | 267 | WP_045797981.1 | hypothetical protein | - |
| ACGHT2_RS07410 (K460107A9_13740) | - | 1410147..1410506 (-) | 360 | WP_390578233.1 | hypothetical protein | - |
| ACGHT2_RS07415 (K460107A9_13750) | - | 1410518..1410712 (-) | 195 | WP_390578235.1 | hypothetical protein | - |
| ACGHT2_RS07420 (K460107A9_13760) | - | 1410709..1411089 (-) | 381 | WP_390578237.1 | hypothetical protein | - |
| ACGHT2_RS07425 (K460107A9_13770) | - | 1411331..1411501 (-) | 171 | WP_390578239.1 | hypothetical protein | - |
| ACGHT2_RS07430 (K460107A9_13780) | - | 1411779..1411967 (-) | 189 | WP_039696597.1 | DNA-binding protein | - |
| ACGHT2_RS07435 (K460107A9_13790) | - | 1412140..1412952 (+) | 813 | WP_390578240.1 | helix-turn-helix domain-containing protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7056.09 Da Isoelectric Point: 4.1370
>NTDB_id=109621 ACGHT2_RS07355 WP_156672679.1 1402163..1402342(-) (prx) [Streptococcus pasteurianus strain k46-0107-A9]
MLYYDEFKEVIEYIKGDTVQIVRKNGIVFDYVLPNEPIKPYEVVTTEKVSDVLEELKEW
MLYYDEFKEVIEYIKGDTVQIVRKNGIVFDYVLPNEPIKPYEVVTTEKVSDVLEELKEW
Nucleotide
Download Length: 180 bp
>NTDB_id=109621 ACGHT2_RS07355 WP_156672679.1 1402163..1402342(-) (prx) [Streptococcus pasteurianus strain k46-0107-A9]
ATGCTGTATTATGATGAATTTAAAGAAGTGATAGAATATATAAAGGGGGATACTGTTCAGATTGTTAGAAAGAATGGGAT
AGTATTTGATTATGTTCTCCCTAATGAGCCTATAAAACCTTACGAGGTGGTTACCACTGAAAAAGTGTCAGACGTTTTGG
AAGAGCTAAAAGAATGGTAG
ATGCTGTATTATGATGAATTTAAAGAAGTGATAGAATATATAAAGGGGGATACTGTTCAGATTGTTAGAAAGAATGGGAT
AGTATTTGATTATGTTCTCCCTAATGAGCCTATAAAACCTTACGAGGTGGTTACCACTGAAAAAGTGTCAGACGTTTTGG
AAGAGCTAAAAGAATGGTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
63.793 |
98.305 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
98.305 |
0.559 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
71.186 |
0.475 |
| prx | Streptococcus pyogenes MGAS315 |
68.293 |
69.492 |
0.475 |
| prx | Streptococcus pyogenes MGAS315 |
65.854 |
69.492 |
0.458 |