Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACJWMC_RS11190 | Genome accession | NZ_CP177181 |
| Coordinates | 2358081..2358269 (-) | Length | 62 a.a. |
| NCBI ID | WP_002892439.1 | Uniprot ID | J7SHM9 |
| Organism | Streptococcus salivarius strain MRD1919 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2356687..2421268 | 2358081..2358269 | within | 0 |
Gene organization within MGE regions
Location: 2356687..2421268
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJWMC_RS11185 | - | 2357173..2357964 (-) | 792 | WP_002892438.1 | hypothetical protein | - |
| ACJWMC_RS11190 | prx | 2358081..2358269 (-) | 189 | WP_002892439.1 | hypothetical protein | Regulator |
| ACJWMC_RS11195 | - | 2358376..2358534 (-) | 159 | WP_002892441.1 | hypothetical protein | - |
| ACJWMC_RS11200 | - | 2358547..2359173 (-) | 627 | WP_037598719.1 | hypothetical protein | - |
| ACJWMC_RS11205 | - | 2359194..2359547 (-) | 354 | WP_002892445.1 | hypothetical protein | - |
| ACJWMC_RS11210 | - | 2359592..2360143 (-) | 552 | WP_002892446.1 | hypothetical protein | - |
| ACJWMC_RS11215 | - | 2360258..2360437 (-) | 180 | WP_002892449.1 | hypothetical protein | - |
| ACJWMC_RS11220 | - | 2360440..2360889 (-) | 450 | WP_224111189.1 | GNAT family N-acetyltransferase | - |
| ACJWMC_RS11225 | - | 2360919..2361419 (-) | 501 | WP_002892451.1 | hypothetical protein | - |
| ACJWMC_RS11230 | - | 2361435..2362082 (-) | 648 | WP_002892453.1 | RadC family protein | - |
| ACJWMC_RS11235 | - | 2362101..2362277 (-) | 177 | WP_002892455.1 | hypothetical protein | - |
| ACJWMC_RS11240 | - | 2362290..2362598 (-) | 309 | WP_037598721.1 | hypothetical protein | - |
| ACJWMC_RS11245 | - | 2362667..2362846 (-) | 180 | WP_037598723.1 | hypothetical protein | - |
| ACJWMC_RS11250 | - | 2363025..2363270 (-) | 246 | WP_037598725.1 | hypothetical protein | - |
| ACJWMC_RS11255 | - | 2363322..2364308 (-) | 987 | WP_002892460.1 | ERF family protein | - |
| ACJWMC_RS11260 | - | 2364364..2365212 (-) | 849 | WP_037598726.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACJWMC_RS11265 | ssb | 2365295..2365723 (-) | 429 | WP_002892464.1 | single-stranded DNA-binding protein | - |
| ACJWMC_RS11270 | - | 2365738..2366106 (-) | 369 | WP_002892465.1 | hypothetical protein | - |
| ACJWMC_RS11275 | - | 2366123..2366443 (-) | 321 | WP_037598727.1 | hypothetical protein | - |
| ACJWMC_RS11280 | - | 2367424..2368716 (-) | 1293 | WP_002892469.1 | hypothetical protein | - |
| ACJWMC_RS11285 | - | 2368832..2369140 (-) | 309 | WP_002892471.1 | hypothetical protein | - |
| ACJWMC_RS11290 | - | 2369154..2369576 (-) | 423 | WP_002892473.1 | hypothetical protein | - |
| ACJWMC_RS11295 | - | 2369653..2369937 (-) | 285 | WP_002892475.1 | hypothetical protein | - |
| ACJWMC_RS11300 | - | 2370079..2370738 (-) | 660 | WP_002892476.1 | hypothetical protein | - |
| ACJWMC_RS11305 | - | 2370900..2371679 (-) | 780 | WP_002892477.1 | hypothetical protein | - |
| ACJWMC_RS11310 | - | 2371698..2372270 (-) | 573 | WP_002892478.1 | hypothetical protein | - |
| ACJWMC_RS11315 | - | 2372462..2373418 (-) | 957 | WP_037598729.1 | hypothetical protein | - |
| ACJWMC_RS11320 | - | 2374087..2374254 (-) | 168 | WP_155115618.1 | hypothetical protein | - |
| ACJWMC_RS11325 | - | 2375293..2378184 (-) | 2892 | WP_002892482.1 | SEC10/PgrA surface exclusion domain-containing protein | - |
| ACJWMC_RS11330 | - | 2378473..2379234 (-) | 762 | WP_002892483.1 | macro domain-containing protein | - |
| ACJWMC_RS11335 | - | 2379231..2381078 (-) | 1848 | WP_037598730.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
| ACJWMC_RS11340 | - | 2381470..2382162 (-) | 693 | WP_002892487.1 | hypothetical protein | - |
| ACJWMC_RS11345 | - | 2382156..2382788 (-) | 633 | WP_002892490.1 | hypothetical protein | - |
| ACJWMC_RS11350 | - | 2382788..2383585 (-) | 798 | WP_002892493.1 | thioredoxin family protein | - |
| ACJWMC_RS11355 | - | 2383726..2384088 (-) | 363 | WP_037598731.1 | hypothetical protein | - |
| ACJWMC_RS11360 | - | 2384106..2385014 (-) | 909 | WP_155115619.1 | replication-relaxation family protein | - |
| ACJWMC_RS11365 | - | 2385915..2386223 (+) | 309 | WP_002892500.1 | hypothetical protein | - |
| ACJWMC_RS11370 | - | 2386264..2389092 (-) | 2829 | WP_238538620.1 | hypothetical protein | - |
| ACJWMC_RS11375 | - | 2389314..2389802 (-) | 489 | WP_002887147.1 | hypothetical protein | - |
| ACJWMC_RS11380 | - | 2389877..2391208 (-) | 1332 | WP_050989618.1 | hypothetical protein | - |
| ACJWMC_RS11385 | - | 2391645..2392478 (-) | 834 | WP_371748860.1 | DNA/RNA non-specific endonuclease | - |
| ACJWMC_RS11390 | - | 2392669..2393652 (-) | 984 | WP_002892509.1 | tyrosine-type recombinase/integrase | - |
| ACJWMC_RS11395 | - | 2393843..2395306 (-) | 1464 | WP_002892510.1 | replication initiation protein | - |
| ACJWMC_RS11400 | - | 2395969..2396493 (-) | 525 | WP_037598734.1 | hypothetical protein | - |
| ACJWMC_RS11405 | - | 2396477..2397307 (-) | 831 | WP_037598735.1 | ParA family protein | - |
| ACJWMC_RS11410 | - | 2398970..2400298 (+) | 1329 | WP_002892518.1 | DUF3854 domain-containing protein | - |
| ACJWMC_RS11415 | - | 2400329..2400931 (+) | 603 | WP_002892520.1 | GTP pyrophosphokinase | - |
| ACJWMC_RS11420 | - | 2401069..2402532 (+) | 1464 | WP_037598738.1 | hypothetical protein | - |
| ACJWMC_RS11425 | - | 2402546..2403319 (+) | 774 | WP_037598740.1 | ATPase, T2SS/T4P/T4SS family | - |
| ACJWMC_RS11430 | - | 2403339..2403845 (+) | 507 | WP_002892526.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| ACJWMC_RS11435 | - | 2403904..2405454 (+) | 1551 | WP_002892528.1 | PcfJ domain-containing protein | - |
| ACJWMC_RS11440 | - | 2405566..2405913 (+) | 348 | WP_141760023.1 | hypothetical protein | - |
| ACJWMC_RS11445 | - | 2405924..2406619 (+) | 696 | WP_002892532.1 | hypothetical protein | - |
| ACJWMC_RS11450 | - | 2406677..2412199 (+) | 5523 | WP_002892534.1 | SNF2-related protein | - |
| ACJWMC_RS11455 | - | 2412776..2412931 (+) | 156 | WP_002887181.1 | type A2 lanthipeptide | - |
| ACJWMC_RS11460 | salM | 2413015..2415849 (+) | 2835 | WP_032491806.1 | salivaricin biosynthesis lanthionine synthetase SalM | - |
| ACJWMC_RS11465 | - | 2415827..2417971 (+) | 2145 | WP_032491807.1 | peptidase domain-containing ABC transporter | - |
| ACJWMC_RS11470 | - | 2417968..2418705 (+) | 738 | WP_002892541.1 | ABC transporter ATP-binding protein | - |
| ACJWMC_RS11475 | - | 2418707..2420614 (+) | 1908 | WP_002887185.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7131.29 Da Isoelectric Point: 5.1186
>NTDB_id=1085979 ACJWMC_RS11190 WP_002892439.1 2358081..2358269(-) (prx) [Streptococcus salivarius strain MRD1919]
MMTFDEVMEAINRGFIKGDKISIVRRNGKIHDYVLPGEKVEPGEIVTEEKVEKVLDELKISR
MMTFDEVMEAINRGFIKGDKISIVRRNGKIHDYVLPGEKVEPGEIVTEEKVEKVLDELKISR
Nucleotide
Download Length: 189 bp
>NTDB_id=1085979 ACJWMC_RS11190 WP_002892439.1 2358081..2358269(-) (prx) [Streptococcus salivarius strain MRD1919]
ATGATGACATTTGATGAAGTAATGGAAGCGATAAACAGAGGGTTTATCAAGGGTGATAAAATCAGTATTGTCCGACGAAA
TGGTAAAATCCATGATTATGTCTTACCAGGAGAGAAAGTAGAGCCTGGAGAAATAGTGACAGAGGAAAAAGTGGAGAAAG
TTCTTGATGAGTTGAAAATAAGTAGGTGA
ATGATGACATTTGATGAAGTAATGGAAGCGATAAACAGAGGGTTTATCAAGGGTGATAAAATCAGTATTGTCCGACGAAA
TGGTAAAATCCATGATTATGTCTTACCAGGAGAGAAAGTAGAGCCTGGAGAAATAGTGACAGAGGAAAAAGTGGAGAAAG
TTCTTGATGAGTTGAAAATAAGTAGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
62.069 |
93.548 |
0.581 |
| prx | Streptococcus pyogenes MGAS8232 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
93.548 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
53.448 |
93.548 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
56.25 |
77.419 |
0.435 |
| prx | Streptococcus pyogenes MGAS315 |
61.905 |
67.742 |
0.419 |
| prx | Streptococcus pyogenes MGAS315 |
62.5 |
64.516 |
0.403 |