Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACJWMC_RS03185 | Genome accession | NZ_CP177181 |
| Coordinates | 630019..630174 (-) | Length | 51 a.a. |
| NCBI ID | WP_002890406.1 | Uniprot ID | J7TX83 |
| Organism | Streptococcus salivarius strain MRD1919 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 630019..641617 | 630019..630174 | within | 0 |
Gene organization within MGE regions
Location: 630019..641617
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJWMC_RS03185 | prx | 630019..630174 (-) | 156 | WP_002890406.1 | hypothetical protein | Regulator |
| ACJWMC_RS03190 | - | 630487..630987 (-) | 501 | WP_002890408.1 | hypothetical protein | - |
| ACJWMC_RS03195 | - | 631020..631442 (-) | 423 | WP_002890409.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACJWMC_RS03200 | - | 631522..631683 (-) | 162 | WP_002890410.1 | hypothetical protein | - |
| ACJWMC_RS03205 | - | 631695..632252 (-) | 558 | WP_002890411.1 | hypothetical protein | - |
| ACJWMC_RS03210 | - | 632352..632507 (-) | 156 | WP_002890413.1 | hypothetical protein | - |
| ACJWMC_RS03215 | - | 632530..633177 (-) | 648 | WP_002890416.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACJWMC_RS03220 | - | 633194..634027 (-) | 834 | WP_037598085.1 | ATP-binding protein | - |
| ACJWMC_RS03225 | - | 634087..634859 (-) | 773 | Protein_586 | DnaD domain protein | - |
| ACJWMC_RS03230 | - | 634831..635106 (-) | 276 | WP_002890421.1 | hypothetical protein | - |
| ACJWMC_RS03235 | - | 635111..635443 (-) | 333 | WP_002890422.1 | hypothetical protein | - |
| ACJWMC_RS03240 | - | 635480..635758 (-) | 279 | WP_002890423.1 | hypothetical protein | - |
| ACJWMC_RS03245 | - | 635770..635979 (-) | 210 | WP_037597579.1 | hypothetical protein | - |
| ACJWMC_RS03250 | - | 635984..636283 (-) | 300 | WP_002890425.1 | hypothetical protein | - |
| ACJWMC_RS03255 | - | 636650..636850 (-) | 201 | WP_002890426.1 | hypothetical protein | - |
| ACJWMC_RS03260 | - | 636867..637064 (-) | 198 | WP_002890427.1 | helix-turn-helix domain-containing protein | - |
| ACJWMC_RS03265 | - | 637229..637813 (+) | 585 | WP_002890428.1 | helix-turn-helix domain-containing protein | - |
| ACJWMC_RS03270 | - | 638085..639065 (+) | 981 | WP_002890429.1 | Abi family protein | - |
| ACJWMC_RS03275 | - | 639126..640292 (+) | 1167 | WP_002890430.1 | tyrosine-type recombinase/integrase | - |
| ACJWMC_RS03280 | - | 640391..640903 (+) | 513 | Protein_597 | PRD domain-containing protein | - |
| ACJWMC_RS03285 | ybeY | 641120..641617 (+) | 498 | WP_002890437.1 | rRNA maturation RNase YbeY | - |
Sequence
Protein
Download Length: 51 a.a. Molecular weight: 5891.65 Da Isoelectric Point: 4.6816
>NTDB_id=1085935 ACJWMC_RS03185 WP_002890406.1 630019..630174(-) (prx) [Streptococcus salivarius strain MRD1919]
MITYDEFKEAIDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHETLSLEKV
MITYDEFKEAIDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHETLSLEKV
Nucleotide
Download Length: 156 bp
>NTDB_id=1085935 ACJWMC_RS03185 WP_002890406.1 630019..630174(-) (prx) [Streptococcus salivarius strain MRD1919]
ATGATAACTTATGATGAATTTAAAGAGGCTATAGACAACGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
CGGTAAGATCCATGACTACGTTTTAGACGGTGAAAGAGTTGAGCCACACGAAACATTGAGTTTAGAAAAAGTATAG
ATGATAACTTATGATGAATTTAAAGAGGCTATAGACAACGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
CGGTAAGATCCATGACTACGTTTTAGACGGTGAAAGAGTTGAGCCACACGAAACATTGAGTTTAGAAAAAGTATAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
64.706 |
100 |
0.647 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
84.314 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
62.745 |
100 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
60.784 |
100 |
0.608 |
| prx | Streptococcus pyogenes MGAS315 |
60.784 |
100 |
0.608 |
| prx | Streptococcus pyogenes MGAS315 |
68.182 |
86.275 |
0.588 |
| prx | Streptococcus pyogenes MGAS315 |
72.5 |
78.431 |
0.569 |