Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACJVC4_RS11170 | Genome accession | NZ_CP177179 |
| Coordinates | 2359901..2360089 (-) | Length | 62 a.a. |
| NCBI ID | WP_002892439.1 | Uniprot ID | J7SHM9 |
| Organism | Streptococcus salivarius strain MRD-NRLLH | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2358507..2423088 | 2359901..2360089 | within | 0 |
Gene organization within MGE regions
Location: 2358507..2423088
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJVC4_RS11165 | - | 2358993..2359784 (-) | 792 | WP_002892438.1 | hypothetical protein | - |
| ACJVC4_RS11170 | prx | 2359901..2360089 (-) | 189 | WP_002892439.1 | hypothetical protein | Regulator |
| ACJVC4_RS11175 | - | 2360196..2360354 (-) | 159 | WP_002892441.1 | hypothetical protein | - |
| ACJVC4_RS11180 | - | 2360367..2360993 (-) | 627 | WP_037598719.1 | hypothetical protein | - |
| ACJVC4_RS11185 | - | 2361014..2361367 (-) | 354 | WP_002892445.1 | hypothetical protein | - |
| ACJVC4_RS11190 | - | 2361412..2361963 (-) | 552 | WP_002892446.1 | hypothetical protein | - |
| ACJVC4_RS11195 | - | 2362078..2362257 (-) | 180 | WP_002892449.1 | hypothetical protein | - |
| ACJVC4_RS11200 | - | 2362260..2362709 (-) | 450 | WP_224111189.1 | GNAT family N-acetyltransferase | - |
| ACJVC4_RS11205 | - | 2362739..2363239 (-) | 501 | WP_002892451.1 | hypothetical protein | - |
| ACJVC4_RS11210 | - | 2363255..2363902 (-) | 648 | WP_002892453.1 | RadC family protein | - |
| ACJVC4_RS11215 | - | 2363921..2364097 (-) | 177 | WP_002892455.1 | hypothetical protein | - |
| ACJVC4_RS11220 | - | 2364110..2364418 (-) | 309 | WP_037598721.1 | hypothetical protein | - |
| ACJVC4_RS11225 | - | 2364487..2364666 (-) | 180 | WP_037598723.1 | hypothetical protein | - |
| ACJVC4_RS11230 | - | 2364845..2365090 (-) | 246 | WP_037598725.1 | hypothetical protein | - |
| ACJVC4_RS11235 | - | 2365142..2366128 (-) | 987 | WP_002892460.1 | ERF family protein | - |
| ACJVC4_RS11240 | - | 2366184..2367032 (-) | 849 | WP_037598726.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ACJVC4_RS11245 | ssb | 2367115..2367543 (-) | 429 | WP_002892464.1 | single-stranded DNA-binding protein | - |
| ACJVC4_RS11250 | - | 2367558..2367926 (-) | 369 | WP_002892465.1 | hypothetical protein | - |
| ACJVC4_RS11255 | - | 2367943..2368263 (-) | 321 | WP_037598727.1 | hypothetical protein | - |
| ACJVC4_RS11260 | - | 2369244..2370536 (-) | 1293 | WP_002892469.1 | hypothetical protein | - |
| ACJVC4_RS11265 | - | 2370652..2370960 (-) | 309 | WP_002892471.1 | hypothetical protein | - |
| ACJVC4_RS11270 | - | 2370974..2371396 (-) | 423 | WP_002892473.1 | hypothetical protein | - |
| ACJVC4_RS11275 | - | 2371473..2371757 (-) | 285 | WP_002892475.1 | hypothetical protein | - |
| ACJVC4_RS11280 | - | 2371899..2372558 (-) | 660 | WP_002892476.1 | hypothetical protein | - |
| ACJVC4_RS11285 | - | 2372720..2373499 (-) | 780 | WP_002892477.1 | hypothetical protein | - |
| ACJVC4_RS11290 | - | 2373518..2374090 (-) | 573 | WP_002892478.1 | hypothetical protein | - |
| ACJVC4_RS11295 | - | 2374282..2375238 (-) | 957 | WP_037598729.1 | hypothetical protein | - |
| ACJVC4_RS11300 | - | 2375907..2376074 (-) | 168 | WP_155115618.1 | hypothetical protein | - |
| ACJVC4_RS11305 | - | 2377113..2380004 (-) | 2892 | WP_002892482.1 | SEC10/PgrA surface exclusion domain-containing protein | - |
| ACJVC4_RS11310 | - | 2380293..2381054 (-) | 762 | WP_002892483.1 | macro domain-containing protein | - |
| ACJVC4_RS11315 | - | 2381051..2382898 (-) | 1848 | WP_037598730.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
| ACJVC4_RS11320 | - | 2383290..2383982 (-) | 693 | WP_002892487.1 | hypothetical protein | - |
| ACJVC4_RS11325 | - | 2383976..2384608 (-) | 633 | WP_002892490.1 | hypothetical protein | - |
| ACJVC4_RS11330 | - | 2384608..2385405 (-) | 798 | WP_002892493.1 | thioredoxin family protein | - |
| ACJVC4_RS11335 | - | 2385546..2385908 (-) | 363 | WP_037598731.1 | hypothetical protein | - |
| ACJVC4_RS11340 | - | 2385926..2386834 (-) | 909 | WP_155115619.1 | replication-relaxation family protein | - |
| ACJVC4_RS11345 | - | 2387735..2388043 (+) | 309 | WP_002892500.1 | hypothetical protein | - |
| ACJVC4_RS11350 | - | 2388084..2390912 (-) | 2829 | WP_238538620.1 | hypothetical protein | - |
| ACJVC4_RS11355 | - | 2391134..2391622 (-) | 489 | WP_002887147.1 | hypothetical protein | - |
| ACJVC4_RS11360 | - | 2391697..2393028 (-) | 1332 | WP_050989618.1 | hypothetical protein | - |
| ACJVC4_RS11365 | - | 2393465..2394298 (-) | 834 | WP_371748860.1 | DNA/RNA non-specific endonuclease | - |
| ACJVC4_RS11370 | - | 2394489..2395472 (-) | 984 | WP_002892509.1 | tyrosine-type recombinase/integrase | - |
| ACJVC4_RS11375 | - | 2395663..2397126 (-) | 1464 | WP_002892510.1 | replication initiation protein | - |
| ACJVC4_RS11380 | - | 2397789..2398313 (-) | 525 | WP_037598734.1 | hypothetical protein | - |
| ACJVC4_RS11385 | - | 2398297..2399127 (-) | 831 | WP_037598735.1 | ParA family protein | - |
| ACJVC4_RS11390 | - | 2400790..2402118 (+) | 1329 | WP_002892518.1 | DUF3854 domain-containing protein | - |
| ACJVC4_RS11395 | - | 2402149..2402751 (+) | 603 | WP_002892520.1 | GTP pyrophosphokinase | - |
| ACJVC4_RS11400 | - | 2402889..2404352 (+) | 1464 | WP_037598738.1 | hypothetical protein | - |
| ACJVC4_RS11405 | - | 2404366..2405139 (+) | 774 | WP_037598740.1 | ATPase, T2SS/T4P/T4SS family | - |
| ACJVC4_RS11410 | - | 2405159..2405665 (+) | 507 | WP_002892526.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| ACJVC4_RS11415 | - | 2405724..2407274 (+) | 1551 | WP_002892528.1 | PcfJ domain-containing protein | - |
| ACJVC4_RS11420 | - | 2407386..2407733 (+) | 348 | WP_141760023.1 | hypothetical protein | - |
| ACJVC4_RS11425 | - | 2407744..2408439 (+) | 696 | WP_002892532.1 | hypothetical protein | - |
| ACJVC4_RS11430 | - | 2408497..2414019 (+) | 5523 | WP_002892534.1 | SNF2-related protein | - |
| ACJVC4_RS11435 | - | 2414596..2414751 (+) | 156 | WP_002887181.1 | type A2 lanthipeptide | - |
| ACJVC4_RS11440 | salM | 2414835..2417669 (+) | 2835 | WP_032491806.1 | salivaricin biosynthesis lanthionine synthetase SalM | - |
| ACJVC4_RS11445 | - | 2417647..2419791 (+) | 2145 | WP_032491807.1 | peptidase domain-containing ABC transporter | - |
| ACJVC4_RS11450 | - | 2419788..2420525 (+) | 738 | WP_002892541.1 | ABC transporter ATP-binding protein | - |
| ACJVC4_RS11455 | - | 2420527..2422434 (+) | 1908 | WP_002887185.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7131.29 Da Isoelectric Point: 5.1186
>NTDB_id=1085840 ACJVC4_RS11170 WP_002892439.1 2359901..2360089(-) (prx) [Streptococcus salivarius strain MRD-NRLLH]
MMTFDEVMEAINRGFIKGDKISIVRRNGKIHDYVLPGEKVEPGEIVTEEKVEKVLDELKISR
MMTFDEVMEAINRGFIKGDKISIVRRNGKIHDYVLPGEKVEPGEIVTEEKVEKVLDELKISR
Nucleotide
Download Length: 189 bp
>NTDB_id=1085840 ACJVC4_RS11170 WP_002892439.1 2359901..2360089(-) (prx) [Streptococcus salivarius strain MRD-NRLLH]
ATGATGACATTTGATGAAGTAATGGAAGCGATAAACAGAGGGTTTATCAAGGGTGATAAAATCAGTATTGTCCGACGAAA
TGGTAAAATCCATGATTATGTCTTACCAGGAGAGAAAGTAGAGCCTGGAGAAATAGTGACAGAGGAAAAAGTGGAGAAAG
TTCTTGATGAGTTGAAAATAAGTAGGTGA
ATGATGACATTTGATGAAGTAATGGAAGCGATAAACAGAGGGTTTATCAAGGGTGATAAAATCAGTATTGTCCGACGAAA
TGGTAAAATCCATGATTATGTCTTACCAGGAGAGAAAGTAGAGCCTGGAGAAATAGTGACAGAGGAAAAAGTGGAGAAAG
TTCTTGATGAGTTGAAAATAAGTAGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
62.069 |
93.548 |
0.581 |
| prx | Streptococcus pyogenes MGAS8232 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
93.548 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
53.448 |
93.548 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
56.25 |
77.419 |
0.435 |
| prx | Streptococcus pyogenes MGAS315 |
61.905 |
67.742 |
0.419 |
| prx | Streptococcus pyogenes MGAS315 |
62.5 |
64.516 |
0.403 |