Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACJVC4_RS03165 | Genome accession | NZ_CP177179 |
| Coordinates | 631209..631364 (-) | Length | 51 a.a. |
| NCBI ID | WP_002890406.1 | Uniprot ID | J7TX83 |
| Organism | Streptococcus salivarius strain MRD-NRLLH | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 631209..649778 | 631209..631364 | within | 0 |
Gene organization within MGE regions
Location: 631209..649778
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJVC4_RS03165 | prx | 631209..631364 (-) | 156 | WP_002890406.1 | hypothetical protein | Regulator |
| ACJVC4_RS03170 | - | 631677..632177 (-) | 501 | WP_002890408.1 | hypothetical protein | - |
| ACJVC4_RS03175 | - | 632210..632632 (-) | 423 | WP_002890409.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACJVC4_RS03180 | - | 632712..632873 (-) | 162 | WP_002890410.1 | hypothetical protein | - |
| ACJVC4_RS03185 | - | 632885..633442 (-) | 558 | WP_002890411.1 | hypothetical protein | - |
| ACJVC4_RS03190 | - | 633542..633697 (-) | 156 | WP_002890413.1 | hypothetical protein | - |
| ACJVC4_RS03195 | - | 633720..634367 (-) | 648 | WP_002890416.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACJVC4_RS03200 | - | 634384..635217 (-) | 834 | WP_037598085.1 | ATP-binding protein | - |
| ACJVC4_RS03205 | - | 635277..636049 (-) | 773 | Protein_581 | DnaD domain protein | - |
| ACJVC4_RS03210 | - | 636021..636296 (-) | 276 | WP_002890421.1 | hypothetical protein | - |
| ACJVC4_RS03215 | - | 636301..636633 (-) | 333 | WP_002890422.1 | hypothetical protein | - |
| ACJVC4_RS03220 | - | 636670..636948 (-) | 279 | WP_002890423.1 | hypothetical protein | - |
| ACJVC4_RS03225 | - | 636960..637169 (-) | 210 | WP_037597579.1 | hypothetical protein | - |
| ACJVC4_RS03230 | - | 637174..637473 (-) | 300 | WP_002890425.1 | hypothetical protein | - |
| ACJVC4_RS03235 | - | 637840..638040 (-) | 201 | WP_002890426.1 | hypothetical protein | - |
| ACJVC4_RS03240 | - | 638057..638254 (-) | 198 | WP_002890427.1 | helix-turn-helix domain-containing protein | - |
| ACJVC4_RS03245 | - | 638419..639003 (+) | 585 | WP_002890428.1 | helix-turn-helix domain-containing protein | - |
| ACJVC4_RS03250 | - | 639275..640255 (+) | 981 | WP_002890429.1 | Abi family protein | - |
| ACJVC4_RS03255 | - | 640316..641482 (+) | 1167 | WP_002890430.1 | tyrosine-type recombinase/integrase | - |
| ACJVC4_RS03260 | - | 641581..642093 (+) | 513 | Protein_592 | PRD domain-containing protein | - |
| ACJVC4_RS03265 | ybeY | 642310..642807 (+) | 498 | WP_002890437.1 | rRNA maturation RNase YbeY | - |
| ACJVC4_RS03270 | - | 642788..643192 (+) | 405 | WP_002890438.1 | diacylglycerol kinase family protein | - |
| ACJVC4_RS03275 | era | 643215..644114 (+) | 900 | WP_002890439.1 | GTPase Era | - |
| ACJVC4_RS03280 | mutM | 644159..644980 (+) | 822 | WP_002890440.1 | DNA-formamidopyrimidine glycosylase | - |
| ACJVC4_RS03285 | coaE | 644977..645570 (+) | 594 | WP_037597583.1 | dephospho-CoA kinase | - |
| ACJVC4_RS03290 | - | 645621..646844 (+) | 1224 | WP_002890442.1 | multidrug efflux MFS transporter | - |
| ACJVC4_RS03295 | rpmG | 646834..646980 (+) | 147 | WP_002890443.1 | 50S ribosomal protein L33 | - |
| ACJVC4_RS03300 | secG | 647026..647262 (+) | 237 | WP_002886135.1 | preprotein translocase subunit SecG | - |
| ACJVC4_RS03305 | rnr | 647325..649778 (+) | 2454 | WP_002890444.1 | ribonuclease R | - |
Sequence
Protein
Download Length: 51 a.a. Molecular weight: 5891.65 Da Isoelectric Point: 4.6816
>NTDB_id=1085795 ACJVC4_RS03165 WP_002890406.1 631209..631364(-) (prx) [Streptococcus salivarius strain MRD-NRLLH]
MITYDEFKEAIDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHETLSLEKV
MITYDEFKEAIDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHETLSLEKV
Nucleotide
Download Length: 156 bp
>NTDB_id=1085795 ACJVC4_RS03165 WP_002890406.1 631209..631364(-) (prx) [Streptococcus salivarius strain MRD-NRLLH]
ATGATAACTTATGATGAATTTAAAGAGGCTATAGACAACGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
CGGTAAGATCCATGACTACGTTTTAGACGGTGAAAGAGTTGAGCCACACGAAACATTGAGTTTAGAAAAAGTATAG
ATGATAACTTATGATGAATTTAAAGAGGCTATAGACAACGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
CGGTAAGATCCATGACTACGTTTTAGACGGTGAAAGAGTTGAGCCACACGAAACATTGAGTTTAGAAAAAGTATAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
64.706 |
100 |
0.647 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
84.314 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
62.745 |
100 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
60.784 |
100 |
0.608 |
| prx | Streptococcus pyogenes MGAS315 |
60.784 |
100 |
0.608 |
| prx | Streptococcus pyogenes MGAS315 |
68.182 |
86.275 |
0.588 |
| prx | Streptococcus pyogenes MGAS315 |
72.5 |
78.431 |
0.569 |