Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | AABA07_RS10390 | Genome accession | NZ_AP028608 |
| Coordinates | 2035785..2035910 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain Sep3 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2030785..2040910
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABA07_RS10360 | - | 2031123..2032726 (-) | 1604 | Protein_2001 | YhgE/Pip domain-containing protein | - |
| AABA07_RS10365 (TKY120829_20150) | - | 2032905..2033447 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| AABA07_RS10380 (TKY120829_20160) | comE | 2033690..2034442 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| AABA07_RS10385 (TKY120829_20170) | comD/comD1 | 2034439..2035764 (-) | 1326 | WP_338172752.1 | competence system sensor histidine kinase ComD | Regulator |
| AABA07_RS10390 (TKY120829_20180) | comC/comC1 | 2035785..2035910 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| AABA07_RS10400 (TKY120829_20190) | rlmH | 2036192..2036671 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| AABA07_RS10405 (TKY120829_20200) | htrA | 2036854..2038035 (+) | 1182 | WP_000681597.1 | trypsin-like peptidase domain-containing protein | Regulator |
| AABA07_RS10410 (TKY120829_20210) | spo0J | 2038093..2038851 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=106402 AABA07_RS10390 WP_000799689.1 2035785..2035910(-) (comC/comC1) [Streptococcus pneumoniae strain Sep3]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=106402 AABA07_RS10390 WP_000799689.1 2035785..2035910(-) (comC/comC1) [Streptococcus pneumoniae strain Sep3]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |