Detailed information NTG1063962

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACG3JE_RS00475
• Genome accession: NZ_CP171736
• Coordinates: 80085..80405 (+)
• Length: 106 a.a.
• NCBI ID: WP_013794397.1
• Uniprot ID: -
• Organism: Streptococcus parauberis strain DB-M17
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 75085..85405

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JE_RS00450 (ACG3JE_00450)	-	75791..77647 (+)	1857	WP_013794401.1	DUF859 family phage minor structural protein	-
ACG3JE_RS00455 (ACG3JE_00455)	-	77696..78034 (+)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JE_RS00460 (ACG3JE_00460)	-	78097..78246 (+)	150	WP_259966511.1	hypothetical protein	-
ACG3JE_RS00465 (ACG3JE_00465)	-	78250..78714 (+)	465	WP_013794399.1	phage holin family protein	-
ACG3JE_RS00470 (ACG3JE_00470)	-	78707..79432 (+)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JE_RS00475 (ACG3JE_00475)	comYC	80085..80405 (+)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JE_RS00480 (ACG3JE_00480)	comGD	80395..80802 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	-
ACG3JE_RS00485 (ACG3JE_00485)	comGE	80774..81073 (+)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	-
ACG3JE_RS00490 (ACG3JE_00490)	-	81051..81299 (+)	249	WP_311981289.1	hypothetical protein	-
ACG3JE_RS00495 (ACG3JE_00495)	-	81272..81487 (+)	216	WP_311981290.1	ComGF family competence protein	-
ACG3JE_RS00500 (ACG3JE_00500)	comGG	81465..81962 (+)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
ACG3JE_RS00505 (ACG3JE_00505)	comYH	82069..83025 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JE_RS00510 (ACG3JE_00510)	-	83081..84274 (+)	1194	WP_003108638.1	acetate kinase	-
ACG3JE_RS00515 (ACG3JE_00515)	-	84385..84597 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JE_RS00520 (ACG3JE_00520)	-	84590..85042 (+)	453	WP_003108634.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11963.03 Da
• Isoelectric Point: 6.9754

>NTDB_id=1063962 ACG3JE_RS00475 WP_013794397.1 80085..80405(+) (comYC) [Streptococcus parauberis strain DB-M17]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 321 bp

>NTDB_id=1063962 ACG3JE_RS00475 WP_013794397.1 80085..80405(+) (comYC) [Streptococcus parauberis strain DB-M17]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	55.556	93.396	0.519
comYC	Streptococcus mutans UA159	55.556	93.396	0.519
comYC	Streptococcus gordonii str. Challis substr. CH1	53.846	85.849	0.462
comGC/cglC	Streptococcus mitis SK321	55.294	80.189	0.443
comGC	Lactococcus lactis subsp. cremoris KW2	52.222	84.906	0.443
comGC/cglC	Streptococcus pneumoniae D39	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae R6	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae TIGR4	52.941	80.189	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	53.571	79.245	0.425