Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | ACG3JJ_RS00990 | Genome accession | NZ_CP171733 |
| Coordinates | 193526..193846 (-) | Length | 106 a.a. |
| NCBI ID | WP_013794397.1 | Uniprot ID | - |
| Organism | Streptococcus parauberis strain DB-M5 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 190905..232117 | 193526..193846 | within | 0 |
Gene organization within MGE regions
Location: 190905..232117
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACG3JJ_RS00965 (ACG3JJ_00965) | comYH | 190905..191861 (-) | 957 | WP_003103712.1 | class I SAM-dependent methyltransferase | Machinery gene |
| ACG3JJ_RS00970 (ACG3JJ_00970) | comGG | 191968..192465 (-) | 498 | WP_003108640.1 | competence type IV pilus minor pilin ComGG | - |
| ACG3JJ_RS00975 (ACG3JJ_00975) | comGF | 192443..192880 (-) | 438 | WP_003102915.1 | competence type IV pilus minor pilin ComGF | - |
| ACG3JJ_RS00980 (ACG3JJ_00980) | comGE | 192858..193157 (-) | 300 | WP_259966510.1 | competence type IV pilus minor pilin ComGE | - |
| ACG3JJ_RS00985 (ACG3JJ_00985) | comGD | 193129..193572 (-) | 444 | WP_307877782.1 | competence type IV pilus minor pilin ComGD | - |
| ACG3JJ_RS00990 (ACG3JJ_00990) | comYC | 193526..193846 (-) | 321 | WP_013794397.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACG3JJ_RS00995 (ACG3JJ_00995) | - | 194499..195224 (-) | 726 | WP_013794398.1 | peptidoglycan amidohydrolase family protein | - |
| ACG3JJ_RS01000 (ACG3JJ_01000) | - | 195217..195681 (-) | 465 | WP_013794399.1 | phage holin family protein | - |
| ACG3JJ_RS01005 (ACG3JJ_01005) | - | 195685..195834 (-) | 150 | WP_259966511.1 | hypothetical protein | - |
| ACG3JJ_RS01010 (ACG3JJ_01010) | - | 195897..196235 (-) | 339 | WP_013794400.1 | DUF1366 domain-containing protein | - |
| ACG3JJ_RS01015 (ACG3JJ_01015) | - | 196284..198140 (-) | 1857 | WP_013794401.1 | DUF859 family phage minor structural protein | - |
| ACG3JJ_RS01020 (ACG3JJ_01020) | - | 198150..201695 (-) | 3546 | WP_259966512.1 | phage tail protein | - |
| ACG3JJ_RS01025 (ACG3JJ_01025) | - | 201695..203140 (-) | 1446 | WP_013794404.1 | distal tail protein Dit | - |
| ACG3JJ_RS01030 (ACG3JJ_01030) | - | 203137..206943 (-) | 3807 | WP_013794405.1 | tape measure protein | - |
| ACG3JJ_RS01035 (ACG3JJ_01035) | - | 206963..207550 (-) | 588 | WP_041828613.1 | Gp15 family bacteriophage protein | - |
| ACG3JJ_RS01040 (ACG3JJ_01040) | - | 207553..207951 (-) | 399 | WP_070030361.1 | hypothetical protein | - |
| ACG3JJ_RS01045 (ACG3JJ_01045) | - | 207976..208431 (-) | 456 | WP_041828614.1 | phage tail tube protein | - |
| ACG3JJ_RS01050 (ACG3JJ_01050) | - | 208434..208841 (-) | 408 | WP_003108657.1 | minor capsid protein | - |
| ACG3JJ_RS01055 (ACG3JJ_01055) | - | 208842..209198 (-) | 357 | WP_003108659.1 | minor capsid protein | - |
| ACG3JJ_RS01060 (ACG3JJ_01060) | - | 209198..209524 (-) | 327 | WP_041828616.1 | putative minor capsid protein | - |
| ACG3JJ_RS01065 (ACG3JJ_01065) | - | 209514..209903 (-) | 390 | WP_013794407.1 | hypothetical protein | - |
| ACG3JJ_RS01070 (ACG3JJ_01070) | - | 209944..210195 (-) | 252 | WP_003108665.1 | hypothetical protein | - |
| ACG3JJ_RS01075 (ACG3JJ_01075) | - | 210207..211091 (-) | 885 | WP_003108667.1 | hypothetical protein | - |
| ACG3JJ_RS01080 (ACG3JJ_01080) | - | 211114..211692 (-) | 579 | WP_013794408.1 | phage scaffolding protein | - |
| ACG3JJ_RS01085 (ACG3JJ_01085) | - | 211828..212997 (-) | 1170 | WP_259966513.1 | phage minor capsid protein | - |
| ACG3JJ_RS01090 (ACG3JJ_01090) | - | 212997..214565 (-) | 1569 | WP_259966514.1 | phage portal protein | - |
| ACG3JJ_RS01095 (ACG3JJ_01095) | - | 214577..215887 (-) | 1311 | WP_013794411.1 | PBSX family phage terminase large subunit | - |
| ACG3JJ_RS01100 (ACG3JJ_01100) | - | 215884..216330 (-) | 447 | WP_259966515.1 | stress-induced protein | - |
| ACG3JJ_RS01105 (ACG3JJ_01105) | - | 216462..217277 (-) | 816 | WP_013794412.1 | hypothetical protein | - |
| ACG3JJ_RS01110 (ACG3JJ_01110) | - | 217281..217607 (-) | 327 | WP_041828618.1 | hypothetical protein | - |
| ACG3JJ_RS01115 (ACG3JJ_01115) | - | 217651..218751 (-) | 1101 | WP_013794413.1 | DUF4417 domain-containing protein | - |
| ACG3JJ_RS01120 (ACG3JJ_01120) | - | 218871..219257 (-) | 387 | WP_041828619.1 | hypothetical protein | - |
| ACG3JJ_RS01125 (ACG3JJ_01125) | - | 219244..219423 (-) | 180 | WP_041828620.1 | hypothetical protein | - |
| ACG3JJ_RS01130 (ACG3JJ_01130) | - | 219501..219758 (-) | 258 | WP_259966516.1 | hypothetical protein | - |
| ACG3JJ_RS01135 (ACG3JJ_01135) | - | 219755..219973 (-) | 219 | WP_041828623.1 | hypothetical protein | - |
| ACG3JJ_RS01140 (ACG3JJ_01140) | - | 219966..220367 (-) | 402 | WP_041828624.1 | endodeoxyribonuclease RusA | - |
| ACG3JJ_RS01145 (ACG3JJ_01145) | - | 220357..220902 (-) | 546 | WP_013794414.1 | DUF1642 domain-containing protein | - |
| ACG3JJ_RS01150 (ACG3JJ_01150) | - | 220892..221134 (-) | 243 | WP_041828626.1 | hypothetical protein | - |
| ACG3JJ_RS01155 (ACG3JJ_01155) | - | 221186..221359 (-) | 174 | WP_259966517.1 | hypothetical protein | - |
| ACG3JJ_RS01160 (ACG3JJ_01160) | - | 221362..221547 (-) | 186 | WP_041828628.1 | hypothetical protein | - |
| ACG3JJ_RS01165 (ACG3JJ_01165) | - | 221547..221873 (-) | 327 | WP_003108696.1 | DUF1372 family protein | - |
| ACG3JJ_RS01170 (ACG3JJ_01170) | - | 222216..222464 (-) | 249 | WP_041828629.1 | hypothetical protein | - |
| ACG3JJ_RS01175 (ACG3JJ_01175) | - | 222457..222945 (-) | 489 | WP_003108699.1 | helix-turn-helix domain-containing protein | - |
| ACG3JJ_RS01180 (ACG3JJ_01180) | ssbA | 222960..223487 (-) | 528 | WP_013794415.1 | single-stranded DNA-binding protein | Machinery gene |
| ACG3JJ_RS01185 (ACG3JJ_01185) | - | 223480..223842 (-) | 363 | WP_080560929.1 | helix-turn-helix transcriptional regulator | - |
| ACG3JJ_RS01190 (ACG3JJ_01190) | - | 223839..224372 (-) | 534 | WP_041828630.1 | MazG-like family protein | - |
| ACG3JJ_RS01195 (ACG3JJ_01195) | - | 224374..225405 (-) | 1032 | WP_013794416.1 | DUF1351 domain-containing protein | - |
| ACG3JJ_RS01200 (ACG3JJ_01200) | - | 225409..226080 (-) | 672 | WP_080560930.1 | ERF family protein | - |
| ACG3JJ_RS01205 (ACG3JJ_01205) | - | 226150..226428 (-) | 279 | WP_041828632.1 | hypothetical protein | - |
| ACG3JJ_RS01210 (ACG3JJ_01210) | - | 226430..227383 (-) | 954 | WP_151191588.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACG3JJ_RS01215 (ACG3JJ_01215) | - | 227380..227571 (-) | 192 | WP_003108723.1 | hypothetical protein | - |
| ACG3JJ_RS01220 (ACG3JJ_01220) | - | 227646..227828 (-) | 183 | WP_003108726.1 | hypothetical protein | - |
| ACG3JJ_RS01225 (ACG3JJ_01225) | - | 227865..228068 (-) | 204 | WP_003108729.1 | helix-turn-helix domain-containing protein | - |
| ACG3JJ_RS01230 (ACG3JJ_01230) | - | 228337..229026 (+) | 690 | WP_013794418.1 | LexA family transcriptional regulator | - |
| ACG3JJ_RS01235 (ACG3JJ_01235) | - | 229040..229213 (+) | 174 | WP_192813189.1 | hypothetical protein | - |
| ACG3JJ_RS01240 (ACG3JJ_01240) | - | 229215..229805 (+) | 591 | WP_013794419.1 | hypothetical protein | - |
| ACG3JJ_RS01245 (ACG3JJ_01245) | - | 229831..230238 (+) | 408 | WP_041828634.1 | hypothetical protein | - |
| ACG3JJ_RS01250 (ACG3JJ_01250) | - | 230243..230560 (+) | 318 | WP_041828635.1 | hypothetical protein | - |
| ACG3JJ_RS01255 (ACG3JJ_01255) | - | 230681..232117 (+) | 1437 | WP_003108747.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 106 a.a. Molecular weight: 11963.03 Da Isoelectric Point: 6.9754
>NTDB_id=1063809 ACG3JJ_RS00990 WP_013794397.1 193526..193846(-) (comYC) [Streptococcus parauberis strain DB-M5]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK
Nucleotide
Download Length: 321 bp
>NTDB_id=1063809 ACG3JJ_RS00990 WP_013794397.1 193526..193846(-) (comYC) [Streptococcus parauberis strain DB-M5]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus mutans UA140 |
55.556 |
93.396 |
0.519 |
| comYC | Streptococcus mutans UA159 |
55.556 |
93.396 |
0.519 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
53.846 |
85.849 |
0.462 |
| comGC/cglC | Streptococcus mitis SK321 |
55.294 |
80.189 |
0.443 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
52.222 |
84.906 |
0.443 |
| comGC/cglC | Streptococcus pneumoniae D39 |
52.941 |
80.189 |
0.425 |
| comGC/cglC | Streptococcus pneumoniae R6 |
52.941 |
80.189 |
0.425 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
52.941 |
80.189 |
0.425 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
52.941 |
80.189 |
0.425 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
53.571 |
79.245 |
0.425 |