Detailed information NTG1063798

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: ACG3JF_RS09150
• Genome accession: NZ_CP171732
• Coordinates: 1794939..1795529 (+)
• Length: 196 a.a.
• NCBI ID: WP_003104338.1
• Uniprot ID: A0A0E2U9G5
• Organism: Streptococcus parauberis strain DB-M3
• Function: degradation of ComX; require for competence development (at the early growth phase); repress competence development (at the mid-logarithmic growth phase) (predicted from homology) Competence regulation

Genomic Context

Location: 1789939..1800529

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JF_RS09135 (ACG3JF_09135)	-	1790624..1792075 (-)	1452	WP_003104981.1	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	-
ACG3JF_RS09140 (ACG3JF_09140)	-	1792163..1793800 (+)	1638	WP_003106241.1	polysaccharide biosynthesis protein	-
ACG3JF_RS09145 (ACG3JF_09145)	upp	1793969..1794598 (+)	630	WP_003106242.1	uracil phosphoribosyltransferase	-
ACG3JF_RS09150 (ACG3JF_09150)	clpP	1794939..1795529 (+)	591	WP_003104338.1	ATP-dependent Clp protease proteolytic subunit	Regulator
ACG3JF_RS09155 (ACG3JF_09155)	-	1795722..1796165 (+)	444	WP_003105053.1	YlbF family regulator	-
ACG3JF_RS09160 (ACG3JF_09160)	-	1796168..1796443 (+)	276	WP_003106243.1	YlbG family protein	-
ACG3JF_RS09165 (ACG3JF_09165)	-	1796556..1796687 (-)	132	WP_274518710.1	hypothetical protein	-
ACG3JF_RS09170 (ACG3JF_09170)	-	1796635..1797764 (+)	1130	Protein_1759	ABC transporter substrate-binding protein	-
ACG3JF_RS09175 (ACG3JF_09175)	-	1797803..1798672 (+)	870	WP_003106245.1	branched-chain amino acid ABC transporter permease	-
ACG3JF_RS09180 (ACG3JF_09180)	-	1798675..1799628 (+)	954	WP_003106246.1	branched-chain amino acid ABC transporter permease	-
ACG3JF_RS09185 (ACG3JF_09185)	-	1799629..1800393 (+)	765	WP_003103139.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 196 a.a.
• Molecular weight: 21684.98 Da
• Isoelectric Point: 5.3086

>NTDB_id=1063798 ACG3JF_RS09150 WP_003104338.1 1794939..1795529(+) (clpP) [Streptococcus parauberis strain DB-M3]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKSDVQTIVMGMAASMGTIIASSGTKGKRFMLPNAEYLIHQPMGGAGNGTQQSDMAIVAEQLLKTRKRLEKILADNSGK
TIKVIHRDAERDYWMDAKETLAYGFIDEIMENNSLK

Nucleotide

• Length: 591 bp

>NTDB_id=1063798 ACG3JF_RS09150 WP_003104338.1 1794939..1795529(+) (clpP) [Streptococcus parauberis strain DB-M3]
ATGATTCCTGTTGTTATTGAACAAACAAGTCGTGGTGAACGATCTTATGATATTTACTCACGTTTATTAAAAGATCGTAT
TATTATGTTAACTGGTCCTGTTGAGGATAACATGGCTAATTCTATCATTGCTCAATTGCTATTCTTAGATGCACAAGATA
ATACTAAAGATATTTACCTTTATGTTAATACACCTGGTGGTTCTGTATCTGCTGGTTTAGCAATCGTTGATACAATGAAC
TTCATTAAATCTGATGTCCAAACAATTGTTATGGGGATGGCAGCTTCAATGGGTACAATTATTGCATCATCTGGAACCAA
GGGTAAACGGTTCATGTTACCAAATGCTGAGTATCTAATTCACCAACCAATGGGCGGTGCTGGAAATGGTACACAGCAGT
CGGATATGGCAATCGTTGCGGAGCAATTATTAAAAACCCGTAAACGCTTAGAAAAAATTCTTGCTGATAACAGTGGAAAA
ACAATTAAAGTAATCCATAGAGATGCTGAAAGAGATTATTGGATGGATGCTAAAGAAACTTTAGCTTATGGGTTCATCGA
TGAAATCATGGAAAACAATAGCTTGAAGTAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (11-192)

3D structure

• AlphaFold DB: A0A0E2U9G5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Streptococcus mutans UA159	93.367	100	0.934
clpP	Streptococcus pyogenes JRS4	91.327	100	0.913
clpP	Streptococcus pyogenes MGAS315	91.327	100	0.913
clpP	Lactococcus lactis subsp. cremoris KW2	90.816	100	0.908
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	90.306	100	0.903
clpP	Streptococcus thermophilus LMD-9	88.776	100	0.888
clpP	Streptococcus thermophilus LMG 18311	88.776	100	0.888
clpP	Streptococcus pneumoniae Rx1	86.667	99.49	0.862
clpP	Streptococcus pneumoniae D39	86.667	99.49	0.862
clpP	Streptococcus pneumoniae R6	86.667	99.49	0.862
clpP	Streptococcus pneumoniae TIGR4	86.667	99.49	0.862
clpP	Bacillus subtilis subsp. subtilis str. 168	56.842	96.939	0.551
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	55.44	98.469	0.546