Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | AABA08_RS03325 | Genome accession | NZ_AP028602 |
| Coordinates | 663236..663826 (+) | Length | 196 a.a. |
| NCBI ID | WP_000613477.1 | Uniprot ID | A0A064BX72 |
| Organism | Streptococcus pneumoniae strain PF2 | ||
| Function | degradation of ComX; degradation of ComW (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 639281..693836 | 663236..663826 | within | 0 |
Gene organization within MGE regions
Location: 639281..693836
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABA08_RS03195 | thiM | 639413..640194 (+) | 782 | Protein_632 | hydroxyethylthiazole kinase | - |
| AABA08_RS03200 (TKY092604_06230) | thiE | 640196..640825 (+) | 630 | WP_000468578.1 | thiamine phosphate synthase | - |
| AABA08_RS03205 (TKY092604_06240) | - | 641384..641944 (+) | 561 | WP_000915281.1 | ECF transporter S component | - |
| AABA08_RS03210 (TKY092604_06250) | - | 641945..643330 (+) | 1386 | WP_000522108.1 | ATP-binding cassette domain-containing protein | - |
| AABA08_RS03215 (TKY092604_06260) | - | 643332..643982 (+) | 651 | WP_000241371.1 | energy-coupling factor transporter transmembrane component T | - |
| AABA08_RS03220 (TKY092604_06270) | tenA | 643993..644685 (+) | 693 | WP_000397212.1 | thiaminase II | - |
| AABA08_RS03225 (TKY092604_06280) | thiW | 644690..645214 (+) | 525 | WP_001225550.1 | energy coupling factor transporter S component ThiW | - |
| AABA08_RS03230 (TKY092604_06290) | - | 645214..646017 (+) | 804 | WP_001155185.1 | hydroxyethylthiazole kinase | - |
| AABA08_RS03235 (TKY092604_06300) | thiE | 646010..646642 (+) | 633 | WP_001078223.1 | thiamine phosphate synthase | - |
| AABA08_RS03240 (TKY092604_06310) | thiD | 646851..647642 (-) | 792 | WP_000221739.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| AABA08_RS03245 (TKY092604_06320) | - | 648008..648403 (+) | 396 | WP_001167216.1 | CopY/TcrY family copper transport repressor | - |
| AABA08_RS03250 (TKY092604_06330) | - | 648414..648785 (+) | 372 | WP_000935062.1 | cupredoxin domain-containing protein | - |
| AABA08_RS03255 (TKY092604_06340) | - | 648795..651038 (+) | 2244 | WP_000136321.1 | heavy metal translocating P-type ATPase | - |
| AABA08_RS03260 (TKY092604_06350) | spxB | 651245..653020 (+) | 1776 | WP_000191798.1 | pyruvate oxidase | - |
| AABA08_RS03265 (TKY092604_06360) | - | 653131..653478 (+) | 348 | WP_001052655.1 | VOC family protein | - |
| AABA08_RS03270 | - | 653595..654468 (-) | 874 | Protein_647 | IS630 family transposase | - |
| AABA08_RS03275 (TKY092604_06390) | - | 654892..655212 (+) | 321 | Protein_648 | family 1 glycosylhydrolase | - |
| AABA08_RS03280 (TKY092604_06400) | manA | 655333..656277 (+) | 945 | WP_001294319.1 | mannose-6-phosphate isomerase, class I | - |
| AABA08_RS03285 (TKY092604_06410) | - | 656268..657765 (-) | 1498 | Protein_650 | sodium-dependent transporter | - |
| AABA08_RS03290 (TKY092604_06420) | - | 657848..658593 (+) | 746 | Protein_651 | MerR family transcriptional regulator | - |
| AABA08_RS03295 (TKY092604_06430) | - | 658622..659077 (-) | 456 | WP_001861299.1 | 8-oxo-dGTP diphosphatase | - |
| AABA08_RS03300 (TKY092604_06440) | - | 659097..660272 (-) | 1176 | WP_000680053.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| AABA08_RS03305 (TKY092604_06450) | - | 660331..661176 (-) | 846 | WP_000219939.1 | DegV family protein | - |
| AABA08_RS03310 (TKY092604_06460) | - | 661301..661858 (+) | 558 | WP_000004139.1 | TetR/AcrR family transcriptional regulator | - |
| AABA08_RS03315 (TKY092604_06470) | - | 661877..662344 (+) | 468 | WP_000136976.1 | deoxycytidylate deaminase | - |
| AABA08_RS03320 (TKY092604_06480) | upp | 662433..663062 (+) | 630 | WP_000515974.1 | uracil phosphoribosyltransferase | - |
| AABA08_RS03325 (TKY092604_06490) | clpP | 663236..663826 (+) | 591 | WP_000613477.1 | ATP-dependent Clp protease proteolytic subunit ClpP | Regulator |
| AABA08_RS03330 (TKY092604_06500) | - | 663905..664153 (+) | 249 | WP_000462126.1 | YlbG family protein | - |
| AABA08_RS03335 (TKY092604_06510) | - | 664254..665414 (+) | 1161 | WP_000726141.1 | ABC transporter substrate-binding protein | - |
| AABA08_RS03340 (TKY092604_06520) | - | 665682..666551 (+) | 870 | WP_000941426.1 | branched-chain amino acid ABC transporter permease | - |
| AABA08_RS03345 (TKY092604_06530) | - | 666555..667511 (+) | 957 | WP_000662293.1 | branched-chain amino acid ABC transporter permease | - |
| AABA08_RS03350 (TKY092604_06540) | - | 667511..668275 (+) | 765 | WP_001186003.1 | ABC transporter ATP-binding protein | - |
| AABA08_RS03355 (TKY092604_06550) | - | 668275..668985 (+) | 711 | WP_000114808.1 | ABC transporter ATP-binding protein | - |
| AABA08_RS03360 (TKY092604_06560) | - | 669399..670055 (+) | 657 | WP_000268654.1 | CBS domain-containing protein | - |
| AABA08_RS03365 (TKY092604_06570) | prfB | 670163..671258 (+) | 1096 | WP_097556756.1 | peptide chain release factor 2 | - |
| AABA08_RS03370 (TKY092604_06580) | ftsE | 671276..671968 (+) | 693 | WP_000022268.1 | cell division ATP-binding protein FtsE | - |
| AABA08_RS03375 (TKY092604_06590) | ftsX | 671961..672887 (+) | 927 | WP_000625533.1 | permease-like cell division protein FtsX | - |
| AABA08_RS03380 (TKY092604_06600) | - | 673068..674021 (-) | 954 | WP_001155321.1 | IS30-like element ISSpn8 family transposase | - |
| AABA08_RS03385 (TKY092604_06610) | - | 674418..676598 (+) | 2181 | WP_000974066.1 | PTS transporter subunit IIBC | - |
| AABA08_RS03390 (TKY092604_06620) | - | 676650..677465 (+) | 816 | WP_000670838.1 | endonuclease/exonuclease/phosphatase family protein | - |
| AABA08_RS03395 (TKY092604_06630) | - | 677605..678948 (+) | 1344 | WP_000011015.1 | DEAD/DEAH box helicase | - |
| AABA08_RS03400 (TKY092604_06640) | metK | 679163..680353 (+) | 1191 | WP_000003935.1 | methionine adenosyltransferase | - |
| AABA08_RS03405 (TKY092604_06650) | - | 680906..681841 (+) | 936 | WP_000255160.1 | dihydroorotate oxidase | - |
| AABA08_RS03410 (TKY092604_06660) | holA | 681875..682912 (+) | 1038 | WP_000879657.1 | DNA polymerase III subunit delta | - |
| AABA08_RS03415 (TKY092604_06670) | sodA | 683085..683690 (+) | 606 | WP_000974746.1 | superoxide dismutase SodA | - |
| AABA08_RS03420 (TKY092604_06680) | - | 683846..684376 (+) | 531 | WP_001224352.1 | YutD family protein | - |
| AABA08_RS03425 (TKY092604_06690) | rlmN | 684397..685482 (+) | 1086 | WP_000804638.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| AABA08_RS03430 | - | 685482..685964 (+) | 483 | WP_000976706.1 | VanZ family protein | - |
| AABA08_RS03435 (TKY092604_06700) | - | 685966..687507 (+) | 1542 | WP_000025399.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| AABA08_RS03440 (TKY092604_06710) | - | 687564..688367 (-) | 804 | WP_000731920.1 | peptidylprolyl isomerase | - |
| AABA08_RS03445 (TKY092604_06720) | - | 688450..688662 (-) | 213 | WP_000011696.1 | hypothetical protein | - |
| AABA08_RS03450 | - | 689138..689347 (-) | 210 | WP_000953860.1 | hypothetical protein | - |
| AABA08_RS03455 (TKY092604_06730) | rpsP | 689517..689789 (+) | 273 | WP_000268761.1 | 30S ribosomal protein S16 | - |
| AABA08_RS03460 (TKY092604_06740) | kphA | 689809..690048 (+) | 240 | WP_000379621.1 | RNA-binding protein KphA | - |
| AABA08_RS03465 | - | 690209..690521 (+) | 313 | Protein_686 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| AABA08_RS03470 (TKY092604_06750) | - | 690625..691413 (+) | 789 | WP_000819182.1 | alpha/beta fold hydrolase | - |
| AABA08_RS03475 (TKY092604_06760) | rimM | 691444..691962 (+) | 519 | WP_001105899.1 | ribosome maturation factor RimM | - |
| AABA08_RS03480 (TKY092604_06770) | trmD | 691952..692671 (+) | 720 | WP_000686921.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| AABA08_RS03485 (TKY092604_06780) | - | 692683..693021 (+) | 339 | WP_001196049.1 | ATP cone domain-containing protein | - |
| AABA08_RS03490 (TKY092604_06790) | - | 693051..693371 (-) | 321 | WP_001216108.1 | hypothetical protein | - |
| AABA08_RS03495 (TKY092604_06800) | - | 693469..693684 (+) | 216 | WP_000807422.1 | YdbC family protein | - |
| AABA08_RS03500 | - | 693681..693827 (-) | 147 | WP_000692983.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 196 a.a. Molecular weight: 21358.36 Da Isoelectric Point: 4.4910
>NTDB_id=105873 AABA08_RS03325 WP_000613477.1 663236..663826(+) (clpP) [Streptococcus pneumoniae strain PF2]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQ
SMEKVHADAERDNWMSAQETLEYGFIDEIMANNSLN
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQ
SMEKVHADAERDNWMSAQETLEYGFIDEIMANNSLN
Nucleotide
Download Length: 591 bp
>NTDB_id=105873 AABA08_RS03325 WP_000613477.1 663236..663826(+) (clpP) [Streptococcus pneumoniae strain PF2]
ATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCTTACGATATTTACTCACGTCTTCTCAAAGACCGCAT
CATTATGCTGACAGGTCCGGTTGAAGACAATATGGCTAACTCTGTTATTGCCCAACTGCTTTTCTTGGATGCCCAAGATA
GTACAAAAGATATTTACCTTTATGTCAATACACCAGGTGGTTCTGTTTCAGCTGGTTTGGCAATCGTAGATACCATGAAC
TTTATCAAGGCAGATGTCCAAACCATTGTTATGGGAATGGCTGCATCTATGGGAACAGTCATCGCATCAAGTGGAGCAAA
AGGCAAACGTTTCATGCTTCCAAATGCTGAATACATGATTCACCAACCAATGGGCGGTACAGGTGGTGGTACCCAACAAA
CTGATATGGCTATCGCTGCAGAACACTTGCTCAAAACTCGTAATACCTTGGAAAAAATCTTGGCTGAAAATTCAGGTCAG
TCAATGGAAAAAGTCCATGCAGATGCAGAACGTGATAACTGGATGAGCGCCCAGGAAACACTTGAATATGGCTTTATTGA
TGAAATTATGGCCAACAATTCATTGAACTAA
ATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCTTACGATATTTACTCACGTCTTCTCAAAGACCGCAT
CATTATGCTGACAGGTCCGGTTGAAGACAATATGGCTAACTCTGTTATTGCCCAACTGCTTTTCTTGGATGCCCAAGATA
GTACAAAAGATATTTACCTTTATGTCAATACACCAGGTGGTTCTGTTTCAGCTGGTTTGGCAATCGTAGATACCATGAAC
TTTATCAAGGCAGATGTCCAAACCATTGTTATGGGAATGGCTGCATCTATGGGAACAGTCATCGCATCAAGTGGAGCAAA
AGGCAAACGTTTCATGCTTCCAAATGCTGAATACATGATTCACCAACCAATGGGCGGTACAGGTGGTGGTACCCAACAAA
CTGATATGGCTATCGCTGCAGAACACTTGCTCAAAACTCGTAATACCTTGGAAAAAATCTTGGCTGAAAATTCAGGTCAG
TCAATGGAAAAAGTCCATGCAGATGCAGAACGTGATAACTGGATGAGCGCCCAGGAAACACTTGAATATGGCTTTATTGA
TGAAATTATGGCCAACAATTCATTGAACTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| clpP | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| clpP | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| clpP | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| clpP | Streptococcus thermophilus LMG 18311 |
92.821 |
99.49 |
0.923 |
| clpP | Streptococcus thermophilus LMD-9 |
92.821 |
99.49 |
0.923 |
| clpP | Streptococcus pyogenes JRS4 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus pyogenes MGAS315 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus mutans UA159 |
85.714 |
100 |
0.857 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
85.128 |
99.49 |
0.847 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
84.615 |
99.49 |
0.842 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
58.854 |
97.959 |
0.577 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
58.031 |
98.469 |
0.571 |