Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | ACB691_RS10015 | Genome accession | NZ_CP169739 |
| Coordinates | 1945337..1945918 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus paranthracis strain mr-1B | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1916157..1946492 | 1945337..1945918 | within | 0 |
Gene organization within MGE regions
Location: 1916157..1946492
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB691_RS09845 | - | 1916157..1916363 (+) | 207 | WP_000113545.1 | alpha/beta-type small acid-soluble spore protein | - |
| ACB691_RS09850 | - | 1916600..1917829 (+) | 1230 | WP_033670231.1 | MFS transporter | - |
| ACB691_RS09855 | - | 1917883..1918497 (-) | 615 | WP_001287306.1 | LysE/ArgO family amino acid transporter | - |
| ACB691_RS09860 | - | 1918924..1921889 (-) | 2966 | Protein_1853 | Tn3 family transposase | - |
| ACB691_RS09865 | - | 1922037..1922612 (+) | 576 | WP_001226074.1 | recombinase family protein | - |
| ACB691_RS09870 | - | 1922725..1923570 (+) | 846 | WP_000383881.1 | AraC family transcriptional regulator | - |
| ACB691_RS09875 | - | 1923698..1924273 (+) | 576 | WP_033656251.1 | recombinase family protein | - |
| ACB691_RS09880 | - | 1924528..1924980 (-) | 453 | WP_000701227.1 | hypothetical protein | - |
| ACB691_RS09885 | - | 1925344..1926042 (+) | 699 | WP_000475617.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ACB691_RS09890 | - | 1926415..1926984 (-) | 570 | WP_000957215.1 | histidine phosphatase family protein | - |
| ACB691_RS09895 | - | 1927010..1927183 (-) | 174 | WP_014315595.1 | HIT family protein | - |
| ACB691_RS09900 | istA | 1927298..1928551 (+) | 1254 | WP_000588560.1 | IS21-like element ISBce16 family transposase | - |
| ACB691_RS09905 | istB | 1928548..1929306 (+) | 759 | WP_000993737.1 | IS21-like element ISBce16 family helper ATPase IstB | - |
| ACB691_RS09910 | - | 1929333..1929518 (-) | 186 | WP_078214948.1 | HIT family protein | - |
| ACB691_RS09915 | - | 1929604..1929795 (-) | 192 | Protein_1864 | helix-turn-helix domain-containing protein | - |
| ACB691_RS09920 | - | 1930118..1930981 (+) | 864 | WP_000041618.1 | AraC family transcriptional regulator | - |
| ACB691_RS09925 | - | 1931035..1931388 (+) | 354 | WP_000449611.1 | VOC family protein | - |
| ACB691_RS09930 | - | 1931434..1934487 (-) | 3054 | WP_001055730.1 | Tn3 family transposase | - |
| ACB691_RS09935 | - | 1934484..1935110 (-) | 627 | WP_000690663.1 | recombinase family protein | - |
| ACB691_RS09940 | - | 1935503..1935979 (+) | 477 | WP_000820334.1 | DUF2975 domain-containing protein | - |
| ACB691_RS09945 | - | 1935989..1936219 (+) | 231 | WP_000974627.1 | helix-turn-helix transcriptional regulator | - |
| ACB691_RS09950 | - | 1936304..1937035 (+) | 732 | WP_001040756.1 | alpha/beta fold hydrolase | - |
| ACB691_RS09955 | - | 1937255..1937759 (+) | 505 | Protein_1872 | DUF421 domain-containing protein | - |
| ACB691_RS09960 | - | 1938112..1939605 (+) | 1494 | WP_000454743.1 | phospholipase D-like domain-containing protein | - |
| ACB691_RS09965 | - | 1939853..1939906 (+) | 54 | Protein_1874 | hypothetical protein | - |
| ACB691_RS09970 | - | 1939967..1940401 (+) | 435 | WP_014315598.1 | DUF421 domain-containing protein | - |
| ACB691_RS09975 | - | 1940584..1940724 (+) | 141 | WP_000724271.1 | hypothetical protein | - |
| ACB691_RS09980 | - | 1941334..1941540 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| ACB691_RS09985 | - | 1941634..1942119 (+) | 486 | WP_001170598.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| ACB691_RS09990 | spoVAC | 1942149..1942625 (+) | 477 | WP_000095403.1 | stage V sporulation protein AC | - |
| ACB691_RS09995 | spoVAD | 1942626..1943642 (+) | 1017 | WP_000938965.1 | stage V sporulation protein AD | - |
| ACB691_RS10000 | spoVAE | 1943639..1943989 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| ACB691_RS10005 | - | 1943999..1944205 (+) | 207 | WP_000215902.1 | DUF1657 domain-containing protein | - |
| ACB691_RS10010 | - | 1944226..1945095 (+) | 870 | WP_000018909.1 | DUF421 domain-containing protein | - |
| ACB691_RS10015 | clpP | 1945337..1945918 (+) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| ACB691_RS10020 | - | 1945941..1946492 (-) | 552 | WP_000576160.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=1052709 ACB691_RS10015 WP_001049162.1 1945337..1945918(+) (clpP) [Bacillus paranthracis strain mr-1B]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=1052709 ACB691_RS10015 WP_001049162.1 1945337..1945918(+) (clpP) [Bacillus paranthracis strain mr-1B]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGCGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGCGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |